Recombinant Acidithiobacillus ferrooxidans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Lferr_2257; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993))
Target Names
nuoA
Target Protein Sequence
MLNHYLPVLIFLLVALVVGVAPLLMGSSLGPHRPDSEKLSPYECGFEAFEDARMKFDVRY YLVAILFILFDLEIAFLFPWAVVFDQIGMTGFLAMMLFLAILVVGFIYEWKKGALEWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant nuoA from A. ferrooxidans differ from its native form in terms of structure and function?

Recombinant A. ferrooxidans nuoA protein, particularly when expressed with tags such as the His-tag described in source materials, may exhibit several differences from its native form:

ParameterNative nuoARecombinant His-tagged nuoAImplications for Research
SolubilityMembrane-embeddedOften more soluble due to tagEasier purification but may affect membrane association
Size118 aaExtended with tag sequenceMay impact folding or interaction studies
PurificationDifficult membrane extractionSimplified affinity chromatographyHigher yield but potentially altered activity
LocalizationIntegrated in membrane complexMay not properly integrateFunctional studies require reconstitution
Post-translational modificationsNative modifications presentMay lack organism-specific modificationsMay affect activity or stability
When conducting research with recombinant nuoA, it's essential to validate that the tagged protein retains functionality similar to the native form. This can be accomplished through activity assays comparing membrane fractions from wild-type A. ferrooxidans with reconstituted systems containing the recombinant protein.

What are the optimal storage and handling conditions for recombinant A. ferrooxidans nuoA?

Based on available data, recombinant A. ferrooxidans nuoA requires specific handling to maintain stability and activity:

  • Storage form: The protein is typically supplied as a lyophilized powder and should be briefly centrifuged before opening to ensure all material is at the bottom of the vial .

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Add glycerol to a final concentration of 5-50% (with 50% being optimal) and store in aliquots at -20°C or preferably -80°C .

  • Working conditions: For short-term use, working aliquots can be stored at 4°C for up to one week .

  • Stability considerations: Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity and integrity .
    When designing experiments, it's advisable to prepare small aliquots during the initial reconstitution to minimize freeze-thaw cycles. Additionally, activity assays should be performed periodically to confirm protein functionality, particularly when using older stocks.

What are the optimal expression systems for producing functional recombinant A. ferrooxidans nuoA?

The selection of an expression system for recombinant A. ferrooxidans nuoA requires careful consideration of multiple factors:

Expression SystemAdvantagesLimitationsSuitability for nuoA
E. coliWell-established, high yield, economicalMay improperly fold membrane proteinsDemonstrated success for nuoA
Yeast (P. pastoris)Better for eukaryotic proteins, post-translational modificationsLonger production timePotential alternative for higher yields
Insect cellsSuperior membrane protein foldingExpensive, complex protocolUseful for functional studies requiring proper folding
Cell-free systemsAvoids toxicity issuesLower yield, expensiveGood for proteins toxic to host cells
The research data indicates that E. coli has been successfully used to express recombinant A. ferrooxidans nuoA . When expressing in E. coli, methodological considerations include:
  • Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains are often preferred for membrane proteins.

  • Induction parameters: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) typically improve membrane protein folding.

  • Membrane fraction isolation: Gentle lysis methods such as enzymatic lysis with lysozyme followed by differential centrifugation preserve protein integrity.

  • Detergent screening: A panel of detergents (DDM, LDAO, etc.) should be tested for optimal solubilization while maintaining protein function.
    For functional studies, it's essential to verify that the recombinant protein retains its native activity through appropriate assays measuring electron transfer capacity.

What purification strategies yield the highest purity and activity of recombinant nuoA?

Purifying membrane proteins like nuoA requires specialized approaches to maintain structure and function:

  • Affinity chromatography: For His-tagged nuoA, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides selective capture . Critical parameters include:

    • Imidazole concentration in binding buffer (10-20 mM to reduce non-specific binding)

    • Detergent concentration (typically at or slightly above CMC)

    • Elution gradient versus step elution (gradients often yield higher purity)

  • Size exclusion chromatography (SEC): As a polishing step, SEC separates monomeric nuoA from aggregates and contaminants while allowing buffer exchange to remove imidazole.

  • Ion exchange chromatography: Can be used as an intermediate step based on the protein's theoretical pI calculated from its amino acid sequence.
    Purification success metrics include:

  • Purity >90% as assessed by SDS-PAGE

  • Yield (typically 1-5 mg/L culture for membrane proteins)

  • Specific activity in NADH oxidation assays

  • Monodispersity determined by dynamic light scattering
    Throughout purification, maintaining an appropriate detergent environment is crucial for preventing aggregation and preserving the native-like structure of nuoA.

How can researchers verify the proper folding and functionality of purified recombinant nuoA?

Verifying proper folding and functionality of recombinant nuoA requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Functional activity assays:

    • NADH oxidation rates monitored spectrophotometrically at 340 nm

    • Oxygen consumption measurements using a Clark-type electrode

    • Quinone reduction assays using specific ubiquinone analogs

  • Integration into model membrane systems:

    • Reconstitution into proteoliposomes to assess membrane potential generation

    • Native-like lipid nanodisc incorporation to study protein-lipid interactions

    • Electron microscopy of reconstituted complexes

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to measure interactions with substrates

    • Surface plasmon resonance (SPR) to evaluate binding kinetics

    • Fluorescence-based assays for cofactor binding
      A methodological workflow might include initial quality assessment by CD and thermal shift, followed by activity measurements in detergent micelles, and ultimately functional validation in reconstituted membrane systems that more closely mimic the native environment.

How can researchers effectively incorporate recombinant nuoA into studies of iron metabolism in A. ferrooxidans?

Integrating recombinant nuoA research into broader studies of A. ferrooxidans iron metabolism requires connecting respiratory chain function with iron oxidation pathways:

  • Gene expression correlation studies:

    • Design qRT-PCR experiments targeting nuoA alongside key iron metabolism genes

    • Use stranded mRNA preparation methods as demonstrated in relevant studies

    • Establish expression profiles under varying iron concentrations and oxidation states

  • Protein-protein interaction analysis:

    • Employ pull-down assays using tagged nuoA to identify interaction partners

    • Conduct bacterial two-hybrid screening focused on iron transport proteins

    • Perform cross-linking studies followed by mass spectrometry to capture transient interactions

  • Respiratory chain reconstitution:

    • Create proteoliposome systems containing purified nuoA and other components

    • Measure electron transfer between iron oxidation proteins and the respiratory chain

    • Assess effects of iron availability on respiratory complex assembly and function

  • Mutational studies:

    • Design complementation experiments in nuoA-deficient strains

    • Develop site-directed mutants targeting potential iron-binding residues

    • Quantify changes in iron oxidation rates in various mutant backgrounds
      Methodologically, researchers should consider adapting protocols from studies on Na+-translocating NADH:quinone oxidoreductase that demonstrated connections between respiratory complexes and iron homeostasis . This could include quantitative real-time PCR approaches examining expression of iron transport genes in wildtype versus nuoA-disrupted backgrounds.

What techniques can be used to study the role of nuoA in A. ferrooxidans adaptation to extreme environments?

A. ferrooxidans thrives in acidic, metal-rich environments, making it an excellent model for studying extremophile adaptations. Research methodologies to investigate nuoA's role in these adaptations include:

  • Comparative stress response studies:

    • Expose cultures to varying pH (1-4), temperature, and metal concentrations

    • Monitor nuoA expression changes using qRT-PCR with appropriate reference genes

    • Correlate expression with physiological parameters (growth rate, iron oxidation)

  • Membrane composition analysis:

    • Compare lipid profiles between nuoA-overexpressing and control strains

    • Analyze changes in membrane fluidity under stress using fluorescence anisotropy

    • Quantify protein-to-lipid ratios in membrane fractions using lipidomics/proteomics

  • In situ localization studies:

    • Develop GFP- or epitope-tagged nuoA constructs

    • Visualize subcellular distribution under varying environmental conditions

    • Quantify clustering or redistribution using super-resolution microscopy

  • Genetic manipulation approaches:

    • Construct strains with controlled nuoA expression levels using plasmid systems similar to those described in available research

    • Design experiments using tac promoter systems for inducible expression

    • Verify transformants using colony PCR with appropriate primers

  • Bioenergetic measurements:

    • Develop proton motive force measurement protocols for extreme pH conditions

    • Compare ATP generation efficiency across environmental gradients

    • Correlate nuoA activity with cellular energy status under stress
      These methodologies would help establish whether nuoA plays a direct role in adaptation or stress response in extreme environments, potentially revealing new bioenergetic mechanisms unique to acidophiles.

How does nuoA interact with other subunits in the NADH:quinone oxidoreductase complex?

Understanding nuoA interactions within the NADH:quinone oxidoreductase complex requires specialized approaches for membrane protein complexes:

  • Structural biology approaches:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography of reconstituted sub-complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Genetic interaction mapping:

    • Synthetic lethality screens with other complex components

    • Suppressor mutation analysis to identify functional relationships

    • Coordinate expression analysis across environmental conditions

  • Biochemical interaction studies:

    • Co-immunoprecipitation with antibodies against different subunits

    • Blue native PAGE to preserve native complex interactions

    • Chemical cross-linking followed by mass spectrometry (CXMS)
      Based on studies of similar complexes, nuoA likely contributes to the membrane anchor section of the enzyme, interacting with other membrane subunits . The methodology for confirming these interactions should include:

  • Expression of recombinant nuoA alongside other subunits

  • Detergent screening to identify conditions preserving complex integrity

  • Validation of assembled complexes by activity assays

  • Mapping of interaction sites through mutagenesis of conserved residues
    A model of interactions could be constructed using homology modeling based on more extensively studied bacterial NADH:quinone oxidoreductases, coupled with experimental validation through directed mutagenesis of predicted interface residues.

What experimental design principles should researchers follow when studying nuoA function in bioenergetics?

Designing robust experiments to study nuoA's role in bioenergetics requires careful consideration of multiple factors:

Experimental Design ElementKey ConsiderationsImplementation Strategies
ControlsPositive, negative, and procedural controlsInclude inactive mutants, empty vector controls, and established enzymatic standards
VariablesIndependent, dependent, and controlled variablesClearly define parameters like pH, temperature, substrate concentration
ReplicationTechnical and biological replicatesMinimum three biological replicates with 2-3 technical replicates each
Statistical approachAppropriate tests for data typePre-determine analysis methods and required sample sizes
ValidationOrthogonal techniquesConfirm findings using multiple methodological approaches
Following the PICO framework (Population, Intervention, Comparison, Outcome) outlined in research design literature , researchers should:
  • Population: Clearly define the experimental system (purified protein, membrane fractions, whole cells)

  • Intervention: Specify manipulations (substrate addition, inhibitor treatment, mutation)

  • Comparison: Establish appropriate control conditions

  • Outcome: Define precise measurements (electron transfer rate, proton translocation, ATP synthesis)
    Additionally, applying the FINER criteria (Feasible, Interesting, Novel, Ethical, Relevant) ensures that nuoA research questions are well-constructed and valuable to the field.
    When designing experiments specifically for membrane proteins like nuoA, additional considerations include detergent effects on activity, reconstitution efficiency in artificial systems, and potential artifacts from tags or fusion proteins.

How can researchers optimize qRT-PCR protocols for studying nuoA expression in A. ferrooxidans?

Optimizing qRT-PCR for nuoA expression analysis in the challenging A. ferrooxidans system requires attention to several key methodological aspects:

  • RNA extraction optimization:

    • Use specialized protocols for extremophiles that address low pH and high metal content

    • Implement RiboCop rRNA Depletion Kit for mixed bacterial samples to enrich mRNA

    • Verify RNA integrity using bioanalyzer or gel electrophoresis

  • Reference gene selection:

    • Test multiple candidate reference genes under experimental conditions

    • Analyze stability using algorithms such as geNorm or NormFinder

    • Consider using geometric means of multiple reference genes

  • Primer design for nuoA:

    • Target unique regions verified by sequence alignment

    • Design primers with Tm of 58-62°C and amplicon size of 80-150 bp

    • Validate primer specificity through melt curve analysis and sequencing

  • qRT-PCR optimization:

    • Determine primer efficiency through standard curves (acceptable range: 90-110%)

    • Optimize annealing temperature and MgCl₂ concentration

    • Include no-template and no-RT controls

  • Data analysis considerations:

    • Apply appropriate normalization using validated reference genes

    • Use the 2^(-ΔΔCt) method for relative quantification

    • Implement statistical analysis appropriate for sample size and distribution
      For absolute quantification, researchers should develop standard curves using plasmids containing the target sequence, similar to the plasmid construction approaches described in the literature . This enables precise quantification of nuoA copy numbers under different experimental conditions.

What approaches can resolve contradictory data when studying recombinant nuoA function?

Researchers often encounter contradictory results when studying complex membrane proteins like nuoA. A systematic approach to resolving these contradictions includes:

  • Source evaluation:

    • Assess protein source variability (expression system, purification method)

    • Verify protein quality (purity, homogeneity, post-translational modifications)

    • Validate reagents using orthogonal methods

  • Methodological troubleshooting:

    • Systematically modify assay conditions (pH, ionic strength, temperature)

    • Test alternative detection methods for the same parameter

    • Control for interfering substances in buffers or samples

  • Systematic bias identification:

    • Blind sample preparation and analysis where feasible

    • Randomize experimental order to control for time-dependent factors

    • Include internal standards to normalize instrumental drift

  • Reconciliation strategies:

    • Implement Bayesian analysis to integrate contradictory results

    • Develop mathematical models incorporating multiple datasets

    • Design critical experiments specifically targeting the contradiction
      When faced with contradictory findings regarding nuoA function, researchers should consider whether the protein is being studied in appropriate membrane environments. The function of membrane proteins is highly dependent on lipid composition, which may explain activity differences across studies. Systematic lipid screening using defined proteoliposome systems can help identify optimal conditions that resolve apparently contradictory functional data.

How can CRISPR-Cas systems be utilized for studying nuoA function in A. ferrooxidans?

Applying CRISPR-Cas technology to study nuoA in A. ferrooxidans represents an advanced approach that requires specialized methodologies:

  • CRISPR system adaptation for acidophiles:

    • Modify transformation protocols for low pH tolerance

    • Optimize Cas9 expression using acidophile-compatible promoters

    • Develop screening strategies effective in extreme conditions

  • Guide RNA design for nuoA targeting:

    • Analyze the nuoA sequence for unique PAM sites

    • Design multiple sgRNAs targeting different regions

    • Test gRNA efficiency using in vitro cleavage assays

  • Implementation strategies:

    • Develop a two-plasmid system with regulated Cas9 expression

    • Create template designs for precise modifications (point mutations, tags)

    • Establish counterselection methods for isolating edited strains

  • Phenotypic analysis frameworks:

    • Design growth assays under varying electron donor/acceptor conditions

    • Develop high-throughput screening for respiration-deficient mutants

    • Implement metabolic flux analysis to quantify pathway alterations
      The methodology could build upon transformation techniques similar to those described in the literature , potentially utilizing the tac promoter system for controlled expression of Cas components. Verification of genomic modifications would require optimized PCR protocols and sequencing approaches suitable for the high GC content typically found in A. ferrooxidans.

What proteomics approaches are most effective for studying nuoA interactions and modifications?

Advanced proteomics methodologies offer powerful tools for characterizing nuoA interactions and post-translational modifications:

  • Sample preparation considerations:

    • Optimize membrane protein extraction using specialized detergents

    • Develop fractionation methods preserving protein-protein interactions

    • Implement crosslinking approaches to capture transient interactions

  • Mass spectrometry techniques for membrane proteins:

    • Apply specialized ionization parameters for hydrophobic peptides

    • Develop targeted methods for low-abundance complexes

    • Implement ion mobility separation for improved coverage

  • Post-translational modification analysis:

    • Use neutral loss scanning for phosphorylation site mapping

    • Apply electron transfer dissociation for labile modifications

    • Develop quantitative approaches for modification stoichiometry

  • Data analysis pipelines:

    • Implement specialized search algorithms for membrane proteins

    • Develop statistical frameworks for interaction confidence scoring

    • Create visualization tools for complex interaction networks
      A comprehensive proteomics workflow for nuoA research might include:

  • Affinity purification using tagged nuoA as bait

  • Multi-dimensional liquid chromatography separation

  • High-resolution mass spectrometry with electron transfer dissociation

  • Computational analysis integrating interaction and modification data
    These approaches would allow researchers to map the nuoA interactome under various conditions, potentially revealing novel interactions with iron metabolism components or stress response systems.

How can systems biology approaches integrate nuoA research with broader understanding of A. ferrooxidans metabolism?

Integrating nuoA research into systems-level understanding of A. ferrooxidans requires multidisciplinary approaches:

  • Multi-omics integration frameworks:

    • Develop coordinated sampling for transcriptomics, proteomics, and metabolomics

    • Implement time-course designs capturing dynamic responses

    • Create computational pipelines integrating heterogeneous data types

  • Metabolic modeling approaches:

    • Construct genome-scale metabolic models incorporating respiratory complexes

    • Perform flux balance analysis under varying energy sources

    • Validate predictions through isotope labeling experiments

  • Network analysis methodologies:

    • Apply correlation networks to identify functional modules

    • Develop causality inference models from perturbation experiments

    • Implement machine learning for predictive modeling

  • Visualization and data sharing:

    • Create interactive metabolic maps highlighting nuoA connections

    • Develop standardized data repositories for acidophile research

    • Implement FAIR principles (Findable, Accessible, Interoperable, Reusable)
      Practically, researchers can begin with RNA-seq experiments using methods similar to those described in the literature , coupled with targeted proteomics of respiratory complexes and metabolomics focused on energy intermediates. This multi-omics dataset would form the foundation for network modeling that places nuoA function in the broader context of adaptation to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.