Recombinant Acidithiobacillus ferrooxidans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; AFE_2620; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))
Target Names
nuoK
Target Protein Sequence
MNAGQPTLAAYLILGAMLFSIGVVGVFLNRKNVIILLMAIELLLLAVNINLVAFSRYLGN LDGQVFVFFILTVAAAEAAIGLAILVAYFRNRHSINVDDIDELRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant nuoK differ from native nuoK in Acidithiobacillus ferrooxidans?

Recombinant nuoK typically contains modifications not present in the native protein. When expressed heterologously, recombinant nuoK is commonly fused with affinity tags (such as His-tag) to facilitate purification . These modifications can affect protein folding, stability, and functionality. The recombinant protein is typically expressed in mesophilic hosts like E. coli rather than in the native acidophilic environment, which may result in different post-translational modifications and protein conformation. Researchers should be aware that while the primary sequence remains largely identical, these structural differences might impact experimental results when studying properties dependent on native membrane integration or protein-protein interactions within the respiratory complex.

What are the optimal storage conditions for recombinant Acidithiobacillus ferrooxidans nuoK?

Recombinant A. ferrooxidans nuoK should be stored at -20°C to -80°C for long-term preservation, with aliquoting recommended to prevent protein degradation from repeated freeze-thaw cycles . The protein is typically lyophilized or stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability . For working aliquots, storage at 4°C is appropriate for up to one week. When reconstituting the lyophilized protein, it should be done in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage . These storage practices help preserve the structural integrity and functional activity of this membrane protein component.

What experimental approaches are used to study nuoK function in Acidithiobacillus ferrooxidans?

Several experimental approaches can be employed to study nuoK function:

TechniqueApplicationAdvantagesLimitations
Recombinant expressionProtein production for structural and functional studiesEnables purification and characterizationMay not fully replicate native conformation
Site-directed mutagenesisIdentification of functional residuesPrecise targeting of specific amino acidsRequires efficient expression system
Membrane isolationStudying protein in native lipid environmentPreserves natural protein interactionsComplex purification process
Oxygen consumption assaysMeasuring respiratory activityQuantifies functional outputIndirect measure of nuoK activity
Genomic knockout studiesDetermining essential functionReveals in vivo importanceChallenging in A. ferrooxidans due to limited genetic tools

The limitations in genetic manipulation systems for A. ferrooxidans have historically hindered comprehensive exploration of its physiology, including nuoK function . Most studies rely on comparative genomic analysis, recombinant protein characterization, and biochemical assays of respiratory activity.

How does nuoK contribute to energy metabolism in A. ferrooxidans?

NuoK functions as part of the NADH dehydrogenase complex that couples electron transfer to proton translocation across the membrane. In A. ferrooxidans, this process is particularly important due to the organism's reliance on chemolithoautotrophic growth and its need to maintain cytoplasmic pH neutrality despite its acidic environment. The NADH dehydrogenase complex contributes to the proton motive force that drives ATP synthesis and is involved in reverse electron transport when the organism oxidizes Fe(II) . This reverse electron flow, driven by the natural proton motive force created by the acidic environment, generates reducing power (NADH) that supports carbon fixation and other anabolic processes vital for cellular function in extreme conditions .

What methodological considerations are important when expressing recombinant A. ferrooxidans nuoK in heterologous systems?

When expressing recombinant A. ferrooxidans nuoK in heterologous systems, researchers must address several critical methodological considerations:

The expression host selection is crucial—E. coli is commonly used but may not provide the acidic cytoplasmic conditions or specialized chaperones needed for proper folding of proteins from acidophiles . Codon optimization is essential as A. ferrooxidans has different codon usage patterns than common laboratory expression hosts. Membrane protein expression requires specialized vectors with appropriate signal sequences and promoters that can be regulated to prevent toxicity from membrane protein overexpression.

Temperature modulation during induction (typically lowering to 16-25°C) can improve proper folding of recombinant membrane proteins. Addition of specific detergents during cell lysis and purification is necessary to solubilize and stabilize membrane proteins like nuoK. When designing constructs, researchers should carefully consider the position and type of affinity tags to minimize interference with transmembrane domain insertion and protein function.

For functional studies, reconstitution into liposomes or nanodiscs may be necessary to recreate a membrane environment. Validation of proper folding through circular dichroism or limited proteolysis is recommended before conducting functional assays. These methodological considerations help ensure that the recombinant protein resembles the native state as closely as possible.

How does nuoK expression change under different oxidative stress conditions in Acidithiobacillus ferrooxidans?

Under oxidative stress conditions, A. ferrooxidans modulates the expression of its respiratory chain components, including nuoK, to maintain energy production while minimizing cellular damage. During exposure to high iron concentrations, which can generate reactive oxygen species through Fenton reactions, the expression of NADH dehydrogenase components may be upregulated to support increased energy demands for detoxification mechanisms. The bacterium possesses sophisticated stress response systems that likely coordinate changes in electron transport chain composition with other cellular defenses.

Transcriptomic studies of related acidithiobacilli (such as A. caldus) under salt stress conditions have shown significant changes in the expression of genes involved in energy metabolism . Similar regulatory mechanisms likely exist in A. ferrooxidans, where nuoK expression would be coordinated with other respiratory components to optimize electron flow under stressful conditions while minimizing the production of harmful reactive oxygen species.

Comprehensive methodological approaches to study these expression changes include:

  • RNA-seq analysis comparing gene expression under various stress conditions

  • Quantitative PCR targeting nuoK and related genes

  • Protein-level quantification using targeted proteomics

  • Reporter gene constructs to monitor promoter activity in vivo

  • Chromatin immunoprecipitation to identify transcription factors regulating nuoK expression

What are the comparative differences between nuoK in Acidithiobacillus ferrooxidans and related acidophilic bacteria?

Comparative genomic analysis reveals both conservation and specialization in the nuoK subunit across acidophilic bacteria. While the core function of nuoK in the NADH dehydrogenase complex is preserved, sequence variations reflect adaptations to specific environmental niches and metabolic strategies. A. ferrooxidans nuoK shows key differences in transmembrane domain organization compared to neutrophilic bacteria, likely reflecting adaptations to function optimally in the context of a large pH gradient across the cell membrane.

When comparing A. ferrooxidans with the related acidophile A. caldus, differences in the nuoK sequence correlate with their distinct metabolic capabilities—A. ferrooxidans being capable of iron oxidation while A. caldus specializes in sulfur oxidation . These sequence variations may influence how the NADH dehydrogenase complex interacts with different electron donors and acceptors in their respective metabolic pathways.

Methodological approaches to study these differences include:

  • Multiple sequence alignment to identify conserved and variable regions

  • Homology modeling to predict structural differences

  • Domain swapping experiments to test functional significance of variable regions

  • Heterologous complementation studies in knockout strains

  • Biochemical assays comparing enzyme kinetics and substrate specificity

How does NIH guidelines for recombinant DNA research apply to experiments with recombinant Acidithiobacillus ferrooxidans nuoK?

Research involving recombinant A. ferrooxidans nuoK falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. According to these guidelines, recombinant and synthetic nucleic acid molecules are defined as: "(i) molecules that a) are constructed by joining nucleic acid molecules and b) can replicate in a living cell (i.e., recombinant nucleic acids); (ii) nucleic acid molecules that are chemically or by other means synthesized or amplified, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules (i.e., synthetic nucleic acids); or (iii) molecules that result from the replication of those described in (i) or (ii) above" .

Institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids must comply with these guidelines . For experiments with recombinant nuoK, researchers must:

  • Determine the appropriate biosafety level based on risk assessment

  • Submit protocols to the Institutional Biosafety Committee (IBC) for review

  • Implement required containment measures and safe laboratory practices

  • Maintain proper documentation of experiments and any adverse events

  • Ensure proper training of personnel handling the recombinant materials

Certain experiments may be exempt if "their introduction into a biological system is not expected to present a biosafety risk that requires review by an IBC" or if "the introduction of these nucleic acid molecules into biological systems would be akin to processes of nucleic acid transfer that already occur in nature" .

How can structural analysis of nuoK contribute to understanding bioleaching mechanisms?

Structural analysis of nuoK can provide critical insights into the bioenergetic mechanisms that underpin A. ferrooxidans' remarkable ability to thrive in acidic, metal-rich environments and drive the bioleaching process. The membrane-embedded nature of nuoK positions it at the interface between the extremely acidic extracellular environment and the near-neutral cytoplasm, making it part of the cellular machinery that harnesses energy from this pH gradient.

Advanced structural techniques such as cryo-electron microscopy, X-ray crystallography, and nuclear magnetic resonance spectroscopy can reveal:

  • How nuoK contributes to proton translocation across the membrane

  • Structural adaptations that allow function in extreme pH conditions

  • Interaction surfaces with other respiratory complex components

  • Potential binding sites for metal ions that may regulate activity

Understanding these structural features can inform biotechnological applications, including:

  • Engineering more efficient bioleaching strains with enhanced energy conservation

  • Developing biomimetic approaches for metal extraction

  • Creating biocatalysts that function in acidic industrial processes

  • Designing inhibitors that could control microbially-influenced corrosion

The knowledge gained from structural studies of nuoK and related proteins contributes to our fundamental understanding of how A. ferrooxidans couples energy conservation to metal solubilization in bioleaching operations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.