Recombinant Acidobacterium capsulatum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

Recombinant NADH-quinone oxidoreductase subunit K is derived from the gene nuoK (UniProt ID: C1F9D3) of Acidobacterium capsulatum, a Gram-negative bacterium known for its metabolic flexibility under microaerophilic and nanoxic conditions . The recombinant protein is produced in Escherichia coli with an N-terminal His tag, enabling purification via affinity chromatography. It spans 104 amino acids (aa) and retains full enzymatic activity when reconstituted .

Key roles in metabolism:

  • Facilitates electron transfer from NADH to quinone in the respiratory chain, contributing to proton motive force generation .

  • Part of the 14-subunit NADH:quinone oxidoreductase complex (NDH-I), essential for aerobic and microaerophilic respiration .

Metabolic Adaptation Under Oxygen Limitation

Studies on A. capsulatum reveal that nuoK-containing NDH-I is critical for maintaining redox balance under fluctuating oxygen levels :

  • Respiratory flexibility: At nanomolar O₂ concentrations (0.1 µmol l⁻¹), A. capsulatum shifts from aerobic respiration to a respiro-fermentative strategy. NDH-I activity decreases, while non-proton-pumping NDH-II and bd-type oxidases are upregulated to mitigate NADH/NAD⁺ imbalance .

  • Transcriptional regulation: The nuoK-associated operon (nuoA-N) shows reduced expression under low O₂, except for nuoABC, which remains active to sustain baseline electron transport .

Comparative Analysis With Other Complex I Systems

Table 2: Subunit Conservation in NADH Dehydrogenases

OrganismComplex I SubunitsnuoK Homolog PresenceReference
E. coli14 subunitsYes (NDH-I)
Rhodobacter capsulatus14 subunitsYes (reverse activity)
Acidobacterium capsulatum14 subunitsYes
  • Functional divergence: Unlike mitochondrial complex I, bacterial NDH-I (including A. capsulatum) lacks supernumerary subunits but retains core proton-pumping machinery .

  • Biotechnological utility: Recombinant nuoK enables structural studies of electron transport mechanisms and screens for respiratory inhibitors .

Technical Notes for Experimental Use

  • Reconstitution: Solubilize lyophilized protein in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Activity assays: Pair with NADH oxidation assays or quinone reduction kinetics to validate function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary based on your purchase method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ACP_0287; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Target Names
nuoK
Target Protein Sequence
MVPVAYYLVLSAILFSIGVGAFLIKRNIITIFMSIELMLNAVNLSFVAFANYWRQINHQF SGQIFVFFVMVVAAAEAAVGLAIIIALFRSRSTLNVDQVDLMKL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, whereby four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.