Recombinant Acidobacterium capsulatum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acidobacterium capsulatum Protein CrcB Homolog (crcB)

The Recombinant Acidobacterium capsulatum Protein CrcB homolog (crcB) is a recombinant protein derived from the bacterium Acidobacterium capsulatum. This protein is often expressed in Escherichia coli (E. coli) and is typically fused with an N-terminal His tag to facilitate purification and detection. The CrcB protein is of interest due to its potential role in fluoride ion transport, which helps reduce fluoride toxicity within cells .

2.2. Amino Acid Sequence

The amino acid sequence of the Recombinant Acidobacterium capsulatum Protein CrcB homolog is as follows:

MKYLWVALGGALGALARYTVGVWIYERLGTRFPYGTFAINVTGCFLIGLALTVLDAHMDL SPAWRLAIPTGFIGAYTTFSTFEYETLRAAQHGQMGTAVLYFGSSLALGILAVWLGMVVG NRIVA\text{MKYLWVALGGALGALARYTVGVWIYERLGTRFPYGTFAINVTGCFLIGLALTVLDAHMDL SPAWRLAIPTGFIGAYTTFSTFEYETLRAAQHGQMGTAVLYFGSSLALGILAVWLGMVVG NRIVA}

3.1. Role in Fluoride Transport

CrcB proteins are predicted to function as fluoride transporters, helping to reduce cellular fluoride concentrations and mitigate its toxicity. Studies in other organisms have shown that CrcB proteins are crucial for survival in environments with high fluoride levels .

3.2. Expression and Purification

The recombinant protein is expressed in E. coli, which provides a robust system for large-scale production. The His tag facilitates purification using affinity chromatography, ensuring high purity of the final product .

4.1. Salmonella Dublin CrcB Homolog

  • Species: Salmonella dublin

  • Source: Expressed in E. coli

  • Tag: N-terminal His tag

  • Protein Length: Full-length, 127 amino acids

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE .

4.2. Comparison Table

FeatureAcidobacterium capsulatum CrcBSalmonella dublin CrcB
SpeciesAcidobacterium capsulatumSalmonella dublin
SourceE. coliE. coli
TagN-terminal His tagN-terminal His tag
Protein Length125 amino acids127 amino acids
FormLyophilized powderLyophilized powder
Purity>90%>90%
Storage-20°C/-80°C-20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
crcB; ACP_3316; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Target Names
crcB
Target Protein Sequence
MKYLWVALGGALGALARYTVGVWIYERLGTRFPYGTFAINVTGCFLIGLALTVLDAHMDL SPAWRLAIPTGFIGAYTTFSTFEYETLRAAQHGQMGTAVLYFGSSLALGILAVWLGMVVG NRIVA
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.