Recombinant Acidovorax citrulli ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production of ATP Synthase Subunits

While recombinant AtpB from A. citrulli is not explicitly reported, methodologies for homologous subunits in related species provide a blueprint:

Table 1: Recombinant ATP Synthase Subunits in Acidovorax spp.

SubunitSpeciesHost SystemTagPurityApplicationSource
AtpEA. citrulliE. coliHis>90%Structural studies
AtpBA. ebreusE. coliHis>85%Functional assays
AtpBUnspecifiedE. coliHisN/AEnzyme kinetics

Production Workflow:

  1. Gene Cloning: Amplify atpB from A. citrulli genomic DNA (e.g., strain M6, GenBank CP000512.1) .

  2. Vector Construction: Use plasmids like pET or pGEX for expression in E. coli .

  3. Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) followed by size-exclusion chromatography .

Research Implications and Challenges

  • Functional Redundancy: ATP synthase subunits in A. citrulli may exhibit functional overlap, as seen in other bacteria .

  • Pathogenicity Link: ATP synthase is vital for bacterial survival under stress (e.g., oxidative or thermal), which influences virulence .

  • Knowledge Gaps: No direct studies on A. citrulli AtpB exist; structural predictions rely on homologs like A. ebreus AtpB (UniProt B9MB97) .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve AtpB’s proton channel mechanism.

  • Gene Knockout Models: Assess atpB deletion effects on A. citrulli motility and biofilm formation, as done for ClpA .

  • Plant Interaction Assays: Test recombinant AtpB’s role in suppressing host immunity, akin to effector proteins like AopV .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Aave_0366; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
atpB
Target Protein Sequence
MAAEAHAPTASEYIVHHLQHLQNIKQKSIVDFSVVNIDSVVVGLVLGAIALFAFWLCARK ATSGVPGRFQAAVEILVEMVDNQAKANIHNAESRKFIAPLALTVFVWIFLMNAMDMLPVD LLPAIWAQIYGAAGHDPHHAYLRVVPTADLSTTLGLSTAVLVLCLYYSVKIKGLGGWAHE LVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLFGNMYAGELVFMLIALMGG AAAMSLSGVLLPVGHIIAGSIWAIFHILVITLQAFIFMMLALIYLGQAHEAH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.