Recombinant Acidovorax citrulli Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acidovorax citrulli Large-Conductance Mechanosensitive Channel (mscL)

The Recombinant Acidovorax citrulli Large-Conductance Mechanosensitive Channel (mscL) is a protein expressed in Escherichia coli, derived from the bacterium Acidovorax citrulli. This protein is crucial for maintaining cellular integrity under osmotic stress by acting as a stretch-activated osmotic release valve. It is a member of a family of pore-forming membrane proteins that respond to mechanical stress at the cell membrane by opening to allow the passage of ions, water, and small proteins, thereby preventing cell lysis during osmotic shock .

Structure and Function of mscL

The mscL protein forms a homopentameric channel, with each subunit containing two transmembrane helices. The channel's structure allows it to gate in response to changes in membrane curvature and transbilayer pressure, making it permeable to ions and small molecules when activated . The protein is composed of 143 amino acids in Acidovorax citrulli and is fused with an N-terminal His tag for purification and identification purposes .

Table: Key Features of Recombinant Acidovorax citrulli mscL

FeatureDescription
SpeciesAcidovorax citrulli
SourceExpressed in E. coli
TagN-terminal His tag
LengthFull Length (1-143 amino acids)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt

Research Findings and Applications

Research on mscL channels has highlighted their potential in developing new antibiotics, particularly against drug-resistant bacterial strains. The mechanosensitive properties of these channels make them targets for drugs that could disrupt bacterial cell membrane integrity . Additionally, understanding the function of mscL in Acidovorax citrulli could provide insights into managing bacterial fruit blotch, a disease affecting cucurbit crops caused by this bacterium .

Table: Potential Applications of mscL Research

ApplicationDescription
Antibiotic DevelopmentTargeting mscL for novel antibiotic strategies against drug-resistant bacteria
Plant Disease ManagementUnderstanding mscL's role in Acidovorax citrulli could aid in managing bacterial fruit blotch

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Aave_3697; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
mscL
Target Protein Sequence
MGIAKEFREFAVKGNVIDLAVGVIIGGAFGKIVDSLVNDVIMPIVGLVFGRLDFSNLFLV LGSVPPGTPATLDALRKAGVPVLAHGSFITVAVNFLILAFIIFMMVKQINRLKRAAPPAP PATPAAPPEDIVLLREIRDSLRR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mscL protein in Acidovorax citrulli and what is its function?

The large-conductance mechanosensitive channel (mscL) in Acidovorax citrulli is a membrane protein consisting of 143 amino acids . Mechanosensitive channels function as emergency release valves that protect bacterial cells from osmotic shock by opening in response to increased membrane tension, allowing the release of cytoplasmic solutes. This protein plays a crucial role in bacterial adaptation to osmotic stress conditions by mediating the non-specific efflux of solutes when bacteria face hypoosmotic shock, preventing cell lysis. In A. citrulli, this function is particularly important given the bacterium's adaptation to diverse environmental conditions during its pathogenic lifecycle.

How is recombinant A. citrulli mscL typically produced for research purposes?

Recombinant A. citrulli mscL is typically produced using E. coli expression systems. The process involves:

  • Cloning the mscL gene from A. citrulli genomic DNA

  • Inserting the gene into an expression vector with an N-terminal His-tag

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Purifying the protein using affinity chromatography (His-tag)

  • Lyophilizing the purified protein for long-term storage

The resulting recombinant protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C to -80°C .

How do Group I and Group II A. citrulli strains differ genetically?

Group I and Group II A. citrulli strains show significant genomic differences:

  • Genome size: Group I strains (like M6) have genomes approximately 500 Kb shorter than Group II strains (like AAC00-1)

  • Missing fragments: Eight large fragments (35-120 Kb) present in Group II strains are absent in Group I strains

  • Open reading frames: Group II strain AAC00-1 possesses 532 ORFs absent in Group I strain M6, while M6 has only 123 ORFs absent in AAC00-1

  • Host specificity: These genetic differences likely contribute to Group I strains predominantly infecting non-watermelon cucurbits, while Group II strains are primarily associated with watermelon

  • Plasmid presence: pACM6-like plasmids are present in some Group I strains but likely absent in Group II strains

How does the structure-function relationship of A. citrulli mscL compare with other bacterial mechanosensitive channels?

A. citrulli mscL shares structural features with other bacterial mechanosensitive channels, including:

  • Transmembrane domains: Like other bacterial mscL proteins, A. citrulli mscL contains multiple transmembrane helices that form the channel pore

  • Conserved gating mechanism: The channel opens in response to membrane tension through a conserved mechanism involving conformational changes in the transmembrane domains

  • Channel conductance: The "large-conductance" classification indicates similar pore size and conductance properties to other bacterial mscL proteins

What methodologies are most effective for studying the role of mscL in A. citrulli pathogenicity?

To effectively study mscL's role in A. citrulli pathogenicity, researchers should consider the following methodological approaches:

  • Gene knockout studies: Generate mscL deletion mutants using homologous recombination or CRISPR-Cas9 techniques to assess changes in virulence

  • Complementation assays: Reintroduce wild-type or mutated mscL genes into knockout strains to confirm phenotype restoration

  • Site-directed mutagenesis: Create specific mutations in conserved residues to identify amino acids critical for channel function

  • Patch-clamp electrophysiology: Directly measure channel activity in response to membrane tension under different conditions

  • Virulence assays: Compare knockout and wild-type strains using standard pathogenicity tests, similar to those used for plasmid curing experiments in A. citrulli M6

  • Osmotic challenge experiments: Assess bacterial survival under various osmotic stress conditions

These approaches should be implemented with appropriate controls, including assessments of bacterial growth rates in standard media, to distinguish between direct effects on pathogenicity and indirect effects due to altered bacterial fitness.

How might differences in mscL between Group I and Group II A. citrulli strains contribute to host specificity?

While current research doesn't specifically address mscL variations between A. citrulli groups, potential connections between mscL and host specificity could be explored through:

  • Sequence comparison: Analyzing mscL sequences from multiple Group I and Group II strains to identify consistent variations

  • Expression analysis: Measuring mscL expression levels during infection of different host plants

  • Channel properties: Comparing electrophysiological properties of mscL from different strains

  • Cross-complementation: Testing whether mscL from Group I can functionally replace mscL in Group II strains and vice versa

  • Host environment adaptation: Examining whether mscL differences correlate with osmotic conditions in different host plant tissues

The genomic differences between Group I and Group II strains (with AAC00-1 possessing 532 ORFs absent in M6 and M6 having 123 unique ORFs) suggest possible adaptive differences that might extend to membrane proteins like mscL .

What are the optimal conditions for expressing and purifying recombinant A. citrulli mscL?

For optimal expression and purification of recombinant A. citrulli mscL:

  • Expression system selection:

    • E. coli strain: BL21(DE3) or C41(DE3) (specialized for membrane proteins)

    • Vector: pET series with N-terminal His-tag

    • Induction: IPTG concentration of 0.1-0.5 mM at OD600 of 0.6-0.8

  • Growth conditions:

    • Temperature: 18-25°C after induction (reduces inclusion body formation)

    • Duration: 16-18 hours post-induction

    • Media: Terrific Broth or 2xYT for higher yields

  • Purification strategy:

    • Cell lysis: Sonication or French press in buffer containing 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

    • Detergent: 1% n-Dodecyl-β-D-maltoside (DDM) or LDAO for solubilization

    • Affinity purification: Ni-NTA chromatography with imidazole gradient

    • Size exclusion: Final polishing step to achieve >90% purity

  • Quality control:

    • SDS-PAGE and Western blot to confirm purity and identity

    • Circular dichroism to verify proper folding

    • Mass spectrometry for accurate mass determination

How should researchers design experiments to study mscL in the context of osmotic stress during plant infection?

When designing experiments to study mscL's role during osmotic stress in plant infection:

  • Infection model development:

    • Select appropriate plant hosts (melon for Group I, watermelon for Group II)

    • Establish precise inoculation methods (leaf infiltration, seed inoculation)

    • Create controlled conditions with defined osmotic gradients

  • Bacterial strain construction:

    • Generate mscL knockout mutants

    • Create fluorescently tagged mscL strains for localization studies

    • Develop strains with physiological sensors for in planta monitoring

  • Osmotic challenge design:

    • Apply controlled osmotic shifts during infection

    • Monitor bacterial population dynamics under different osmotic conditions

    • Compare wild-type and mutant strain responses

  • Data collection timeline:

    • Early infection (0-24 hours): Focus on initial adaptation

    • Mid-infection (2-5 days): Monitor population establishment, similar to timeframes used in virulence assays with A. citrulli M6

    • Late infection (>5 days): Assess long-term survival and symptom development

  • Control considerations:

    • Include parallel in vitro osmotic challenges

    • Assess other channels (e.g., MscS) to distinguish mscL-specific effects

    • Monitor plant defensive responses that might create osmotic stress

How should researchers interpret conflicting data on mscL function between in vitro studies and in planta experiments?

When facing conflicting results between in vitro and in planta experiments:

  • Technical validation steps:

    • Verify protein expression and localization in both conditions

    • Ensure experimental conditions accurately represent the respective environments

    • Validate assay sensitivity and specificity in both contexts

  • Contextual analysis framework:

    • Consider the complex plant environment versus controlled in vitro conditions

    • Analyze potential plant factors that might modify mscL function

    • Examine bacterial gene expression differences between conditions

  • Reconciliation strategies:

    • Develop intermediate models bridging the complexity gap

    • Design experiments with increasing environmental complexity

    • Utilize mathematical modeling to identify key variables causing discrepancies

  • Interpretative approaches:

    • Consider adaptive responses that might compensate for mscL dysfunction in planta

    • Examine potential redundant systems activated in one condition but not the other

    • Analyze interaction effects with other bacterial functions

This analytical approach mirrors the complexity seen in A. citrulli plasmid research, where growth differences observed in laboratory conditions required careful interpretation to distinguish plasmid effects from experimental artifacts .

What statistical considerations are important when analyzing mscL protein function across different A. citrulli strains?

When statistically analyzing mscL function across A. citrulli strains:

  • Experimental design considerations:

    • Use sufficient biological replicates (minimum n=3, ideally n≥5)

    • Include technical replicates to account for measurement variation

    • Employ balanced designs across Group I and Group II strains

  • Statistical methods selection:

    • Apply ANOVA with appropriate post-hoc tests (e.g., Tukey's HSD) for multi-strain comparisons

    • Consider non-parametric alternatives when normality assumptions are violated

    • Implement mixed-effects models when incorporating multiple experimental factors

  • Variation sources to account for:

    • Inter-group differences (Group I vs. Group II)

    • Intra-group strain variation

    • Experimental batch effects

    • Host plant genotype influences

  • Data normalization approaches:

    • Select appropriate housekeeping genes for expression studies

    • Normalize channel activity to membrane protein content

    • Account for growth rate differences between strains

These statistical approaches align with methodologies used in A. citrulli virulence studies, where careful statistical analysis was required to detect significant differences in pathogenicity assays .

How might understanding of A. citrulli mscL contribute to novel bacterial fruit blotch management strategies?

Understanding mscL in A. citrulli could lead to innovative disease management through:

  • Targeted inhibitor development:

    • Design of small molecules that specifically block mscL function

    • Development of peptides that interfere with channel gating

    • Creation of compounds that alter channel sensitivity to osmotic stress

  • Host resistance enhancement:

    • Identification of plant compounds that naturally inhibit mscL

    • Engineering of plant varieties that produce mscL-targeting antimicrobials

    • Development of crops that create unfavorable osmotic environments

  • Biocontrol applications:

    • Engineering of competing bacteria with enhanced mscL function

    • Development of biological treatments that create osmotic stress for A. citrulli

    • Design of phage therapies targeting bacteria under mscL-dependent stress

  • Diagnostic improvements:

    • Creation of mscL-based detection methods for field diagnosis

    • Development of strain-typing approaches based on mscL variation

    • Establishment of predictive models for strain virulence based on mscL properties

These applications would complement current management strategies, potentially addressing the significant crop losses currently attributed to bacterial fruit blotch in cucurbit production worldwide.

What are the most promising directions for future research on A. citrulli mscL?

The most promising directions for future A. citrulli mscL research include:

  • Structural biology approaches:

    • High-resolution structural determination of A. citrulli mscL

    • Comparative structural analysis between Group I and Group II mscL variants

    • Investigation of mscL interactions with other membrane components

  • Systems biology integration:

    • Multi-omics approaches to place mscL in broader stress response networks

    • Network analysis of mscL regulation during different infection stages

    • Modeling of osmotic response pathways in the context of host infection

  • Evolutionary perspectives:

    • Analysis of mscL sequence evolution across A. citrulli populations

    • Investigation of horizontal gene transfer influences on mscL diversity

    • Examination of selection pressures on mscL in different host environments

  • Translational research opportunities:

    • Development of high-throughput screening systems for mscL inhibitors

    • Creation of field-deployable technologies based on mscL biology

    • Engineering of synthetic biology tools utilizing mscL properties

These research directions would significantly advance our understanding of both A. citrulli pathogenicity and fundamental bacterial osmoadaptation mechanisms, potentially yielding valuable applications beyond plant pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.