Recombinant Acidovorax citrulli Probable intracellular septation protein A (Aave_2949)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
yciB; Aave_2949; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
Aave_2949
Target Protein Sequence
MKLLIDFFPIILFFVAFKVWGIYTATAVAIAATVAQIAYLRIRHGRIEPMQWVSLGVIVV FGGATLLSHSETFIKWKPTVLYWLMGGALLVGQLFFRKNLIRTLMGGQMELPDAAWRAMN WSWTAFFAAMGAINLWVAHAFSTDTWVNFKLFGGIGLMAVFVIGQALYLSRYMKEPQDDA RTAPEDAKP
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aave_2949 and what is its role in Acidovorax citrulli?

Aave_2949 is a probable intracellular septation protein A found in Acidovorax citrulli (strain AAC00-1), primarily involved in cell division processes. It belongs to the YciB family of proteins and is believed to play a crucial role in intracellular septation - the process of forming septa during bacterial cell division. The protein consists of 189 amino acids with a molecular mass of approximately 21.257 kDa . Studies of homologous proteins in other bacterial species, such as the ispA gene in Shigella flexneri, suggest that intracellular septation proteins are essential for maintaining proper cell morphology during intracellular growth and can significantly impact virulence mechanisms .

What are the recommended protocols for expressing and purifying recombinant Aave_2949?

For efficient expression and purification of recombinant Aave_2949:

  • Expression system selection: E. coli is the preferred heterologous expression system due to its compatibility with this bacterial protein .

  • Vector construction:

    • Clone the full-length sequence (amino acids 1-189) into an expression vector with an N-terminal His-tag

    • Include appropriate restriction sites for directional cloning

    • Verify correct insertion by sequencing

  • Expression optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, etc.)

    • Optimize induction conditions (IPTG concentration, temperature, duration)

    • Consider lower temperatures (16-20°C) during induction due to the protein's hydrophobic nature

  • Purification strategy:

    • Use denaturing conditions with 8M urea for initial extraction due to its high hydrophobicity

    • Perform immobilized metal affinity chromatography (IMAC)

    • Consider on-column refolding with gradually decreasing urea concentrations

    • Final buffer should contain appropriate detergents (0.1% DDM or similar) to maintain solubility

  • Storage recommendations:

    • Store at -20°C/-80°C in Tris/PBS-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Aliquot for single use

What functional assays can be used to study Aave_2949's role in septation?

To investigate Aave_2949's function in septation processes:

  • Gene knockout/complementation studies:

    • Generate Aave_2949 deletion mutants using homologous recombination

    • Perform phenotypic characterization focusing on cell morphology and division

    • Complement with wild-type gene to confirm phenotype restoration

    • Use microscopy to assess septum formation and cell division defects

  • Fluorescence microscopy approaches:

    • Create fluorescent protein fusions (GFP-Aave_2949) to track localization

    • Use time-lapse microscopy to monitor septum formation during cell division

    • Apply bacterial cytological profiling to assess effects on cellular structures

  • Bacterial two-hybrid or pull-down assays:

    • Identify protein interaction partners involved in septation

    • Focus on proteins of the divisome complex and cell wall synthesis machinery

  • Cell morphology analysis:

    • Scanning electron microscopy to examine surface characteristics

    • Transmission electron microscopy to visualize septum formation

    • Phase-contrast microscopy for cell filamentation analysis

  • Growth curve analysis:

    • Compare wild-type and mutant growth rates under different conditions

    • Assess response to cell division inhibitors

How does Aave_2949 contribute to Acidovorax citrulli pathogenicity in cucurbit hosts?

While direct evidence specifically linking Aave_2949 to A. citrulli pathogenicity remains limited, research on homologous septation proteins in other pathogens provides important insights:

  • Infection process implications:

    • Proper cell division is critical during host colonization, and disruption of septation processes can significantly impair bacterial proliferation within host tissues

    • Studies with the ispA homolog in Shigella demonstrated that mutations affecting intracellular septation lead to bacterial filamentation and reduced virulence

  • Host-pathogen interaction mechanisms:

    • Bacterial morphology affects recognition by host immune systems

    • Cell division proteins may indirectly influence type III secretion system (T3SS) organization

    • Altered septation can affect membrane integrity and bacterial stress responses during infection

  • Experimental evidence from related pathogens:

    • In Shigella, ispA mutations resulted in defective intercellular spreading and reduced virulence

    • Filamentous bacteria lacking septa become trapped within host cells

    • Septation defects affect actin polymerization capabilities, which are essential for pathogen movement within host cells

To fully characterize Aave_2949's role in pathogenicity, researchers should:

  • Generate targeted knockouts in diverse A. citrulli strains

  • Perform pathogenicity assays on different cucurbit hosts

  • Examine bacterial proliferation within plant tissues

  • Analyze virulence factor expression in mutant strains

How do different A. citrulli genetic groups vary in their virulence mechanisms, and what role might Aave_2949 play?

A. citrulli strains are divided into distinct genetic groups with differential host preferences:

  • Group differentiation and host specificity:

    • Group I strains: Primarily isolated from non-watermelon hosts, especially melon

    • Group II strains: Generally isolated from and more virulent on watermelon

    • A third lineage has been suggested by some studies

  • Virulence factor variation:

    • Type III secreted effectors differ between groups, reflecting host adaptation

    • Differences in effector repertoires likely contribute to host range determination

    • Specific effectors like AopW1 show variation between groups, with distinct host activity profiles

  • Potential role of Aave_2949 in group-specific virulence:

    • Comparative sequence analysis across groups could reveal adaptive variations

    • Functional differences in intracellular septation might affect bacterial persistence in different host environments

    • Expression level differences during infection of various hosts might be observed

  • Methodological approaches to investigate group differences:

    • Sequence comparison of Aave_2949 across multiple strains from each group

    • Cross-complementation experiments between groups

    • Host-specific expression analysis during infection

    • Construction of chimeric proteins to identify host-specificity determinants

How can Aave_2949 be utilized in the development of detection methods for A. citrulli in agricultural settings?

While direct detection methods targeting Aave_2949 are not well-established, understanding its conservation across A. citrulli strains provides opportunities for diagnostic development:

  • PCR-based detection approaches:

    • Design specific primers targeting conserved regions of Aave_2949

    • Develop multiplex PCR assays combining Aave_2949 with other target genes

    • Implement real-time PCR for quantitative detection in plant tissues

  • Integration with LAMP-LFD technology:

    • Loop-mediated isothermal amplification (LAMP) paired with lateral flow detection (LFD) offers rapid field-deployable testing

    • Sensitivity levels of 1 fg/μL for A. citrulli genomic DNA have been achieved with other targets

    • Aave_2949-targeted LAMP-LFD could provide similar sensitivity with proper primer design

  • Immunological detection methods:

    • Generate specific antibodies against recombinant Aave_2949

    • Develop ELISA-based detection systems for field samples

    • Create immunofluorescence assays for visual confirmation in plant tissues

  • Optimization for field applications:

    • Sampling protocols from symptomatic and asymptomatic tissues

    • Sample processing to maximize bacterial extraction

    • Quality control measures to minimize false positives/negatives

    • Validation across diverse environmental conditions

How might Aave_2949 interact with other bacterial proteins during infection, and what techniques can explore these interactions?

Understanding Aave_2949's protein interaction network requires sophisticated approaches:

  • Potential interaction partners:

    • Cell division proteins (FtsZ, FtsA, ZipA)

    • Cell wall synthesis machinery

    • Membrane proteins involved in virulence

    • Type III secretion system components

  • Advanced interaction mapping techniques:

    • Crosslinking mass spectrometry (XL-MS):

      • In vivo crosslinking followed by pulldown of Aave_2949

      • Mass spectrometry identification of crosslinked partners

      • Structural characterization of interaction interfaces

    • BioID or APEX proximity labeling:

      • Generate Aave_2949 fusions with biotin ligase

      • Express in A. citrulli during infection conditions

      • Identify proteins in spatial proximity through biotinylation

    • Co-immunoprecipitation with targeted verification:

      • Pull down Aave_2949 complexes under various conditions

      • Western blot analysis for suspected interaction partners

      • Analyze condition-dependent interaction dynamics

  • Functional validation approaches:

    • Bacterial two-hybrid confirmation of direct interactions

    • Fluorescence resonance energy transfer (FRET) to verify interactions in vivo

    • Co-localization studies using fluorescently tagged proteins

    • Mutagenesis of interaction domains to disrupt specific partnerships

What computational approaches can predict Aave_2949's structure-function relationships and guide experimental design?

Advanced computational analyses provide powerful insights into Aave_2949 function:

  • Structural prediction methods:

    • AlphaFold2/RosettaFold modeling:

      • Generate high-confidence 3D structural models

      • Identify potential functional domains and active sites

      • Analyze membrane topology and insertion

    • Molecular dynamics simulations:

      • Model protein behavior in membrane environments

      • Investigate conformational changes during function

      • Predict effects of mutations on protein stability

  • Comparative genomics approaches:

    • Phylogenetic analysis across bacterial species:

      • Identify conserved functional motifs

      • Detect signatures of selection pressure

      • Trace evolutionary history of the YciB family

    • Structural comparison with known septation proteins:

      • Identify shared structural features with characterized homologs

      • Map functional domains across diverse bacterial species

      • Predict critical residues for function

  • Integrative bioinformatics:

    • Combine transcriptomic data with structural predictions

    • Analyze co-evolved residues to predict interaction sites

    • Use systems biology approaches to place in cellular pathways

  • Experimental validation of computational predictions:

    • Site-directed mutagenesis of predicted functional residues

    • Domain deletion studies guided by structural predictions

    • Creation of chimeric proteins based on comparative analysis

What are the common challenges in working with recombinant Aave_2949, and how can they be addressed?

Working with Aave_2949 presents several technical challenges due to its hydrophobic nature and membrane association:

  • Expression and solubility issues:

    • Challenge: Poor expression or inclusion body formation

    • Solutions:

      • Use specialized E. coli strains (C41/C43) designed for membrane proteins

      • Reduce induction temperature to 16-18°C

      • Try expression as fusion with solubility enhancers (MBP, SUMO)

      • Consider cell-free expression systems for toxic proteins

  • Purification difficulties:

    • Challenge: Low yield and protein aggregation

    • Solutions:

      • Optimize detergent selection (test DDM, LDAO, FC-12)

      • Implement on-column refolding protocols

      • Use size exclusion chromatography to remove aggregates

      • Consider purification under denaturing conditions followed by controlled refolding

  • Functional assay limitations:

    • Challenge: Difficulty in demonstrating septation function in vitro

    • Solutions:

      • Develop liposome reconstitution systems

      • Use bacterial spheroplasts for functional studies

      • Implement genetic complementation in heterologous hosts

      • Apply microscopy techniques to visualize protein localization

  • Storage and stability concerns:

    • Challenge: Protein degradation during storage

    • Solutions:

      • Add appropriate protease inhibitors

      • Store in buffer containing 50% glycerol

      • Prepare single-use aliquots to avoid freeze-thaw cycles

      • Validate protein integrity before experiments

How can researchers overcome the challenges of studying Aave_2949 function in the context of host-pathogen interactions?

Investigating Aave_2949's role during infection presents unique challenges:

  • Genetic manipulation obstacles:

    • Challenge: Difficulty creating targeted mutations in A. citrulli

    • Solutions:

      • Optimize electroporation conditions for different A. citrulli strains

      • Use CRISPR-Cas9 system adapted for A. citrulli

      • Consider conditional knockdown approaches if deletions are lethal

      • Implement homologous recombination with antibiotic selection markers

  • Host plant infection model limitations:

    • Challenge: Variability in plant infection assays

    • Solutions:

      • Standardize inoculation methods (soil drenching, syringe infiltration, vacuum infiltration)

      • Control environmental conditions rigorously during experiments

      • Use multiple plant genotypes to account for host variation

      • Implement quantitative bacterial recovery assays from tissues

  • In planta bacterial visualization:

    • Challenge: Difficult to track bacterial behavior in plant tissues

    • Solutions:

      • Generate fluorescent protein-tagged A. citrulli strains

      • Use confocal microscopy for tissue penetration

      • Implement tissue clearing techniques to improve visualization

      • Combine with immunolocalization for protein-specific detection

  • Distinguishing direct vs. indirect effects:

    • Challenge: Separating primary from secondary phenotypes

    • Solutions:

      • Design complementation studies with point mutations

      • Use inducible expression systems to control timing

      • Implement time-course experiments to track sequential events

      • Combine with transcriptomic/proteomic approaches to assess global changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.