Recombinant Acidovorax citrulli Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Aave_3641; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
ubiB
Target Protein Sequence
MSRLFRGATIVWVVLRYGLDELVLTSFQKPWLRLLARIVSFGRKLDAPRGQRLREALERL GPIFVKFGQVLSTRRDLLPPDIANELALLQDRVPPFDPDVAVATIERAFRRPVGEVFVSF ERVPVASASIAQVHFAIVRDRHGVEREVAVKVLRPGMLPVIDNDLGLMRAMAGWVESLSA DGKRLKPRQVVAEFDNYLHDELDLIREAANAAQLRRNMERLGLVRIPEILWDFCHPEVLV MERMKGVPISQIERLRAAGVDIRQLARDGVTIFFTQVFRDGFFHADMHPGNIQVSLEPGS FGRYISLDFGIVGSLTEFDKEYLAQNFTAFFRRDYKRVAELHVESGWVPADTRINELESA IRAVCEPYFDRPLKEISLGMVLMRLFQTSRRFHVEIQPQLVLLQKTLLNIEGLGRQLDPE LDLWSTAKPFLEKWMLDQMGPQRLWREVKAESPHFAKMLPELPRLLHDYLHHKPHDHRRE MQELLAEQRRTNRLLQSIIYGGMGFVLGLLALQFLIRIRFFH
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of UbiB protein in Acidovorax citrulli?

    UbiB is a probable ubiquinone biosynthesis protein in Acidovorax citrulli that plays a crucial role in the biosynthesis pathway of ubiquinone (Coenzyme Q). Based on homology to other bacterial UbiB proteins, it likely functions as a protein kinase involved in the early steps of ubiquinone biosynthesis, particularly in the conversion of 2-octaprenylphenol to 2-octaprenyl-6-hydroxyphenol. This process is critical for bacterial energy metabolism, as ubiquinone is an essential component of the electron transport chain.

    In the context of A. citrulli as a pathogen, UbiB's role in maintaining cellular energy production may be particularly important during infection of cucurbit hosts, where the bacterium must adapt to the plant environment and overcome host defense mechanisms .

  • What expression systems are commonly used for recombinant production of A. citrulli UbiB?

    Based on available data, E. coli has been successfully used as an expression system for recombinant A. citrulli UbiB protein. The methodology typically involves:

    • Vector selection: pET series vectors with T7 promoters for high-level expression

    • Host strain: E. coli BL21(DE3) or derivatives optimized for protein expression

    • Affinity tag: N-terminal His-tag for purification by immobilized metal affinity chromatography

    • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Storage recommendations: Addition of 5-50% glycerol and storage at -20°C/-80°C to prevent degradation from freeze-thaw cycles

    When expressing membrane-associated proteins like UbiB, optimization of temperature (typically lowering to 16-18°C), IPTG concentration, and inclusion of solubility enhancers may improve yield and solubility .

  • How does the genetic structure of UbiB differ between Group I and Group II strains of A. citrulli?

    While the search results don't directly address UbiB gene differences between the two major groups of A. citrulli, comprehensive genome comparisons provide context for potential variations.

    Group I strains (typically isolated from melon and non-watermelon cucurbits) have genomes approximately 500 kb shorter than Group II strains (associated with watermelon). This size difference is explained by eight genomic fragments present in the Group II strain AAC00-1 but absent in the Group I strain M6.

    Analysis of G+C content and ENC (effective number of codon) values of these differential fragments suggests they were likely acquired by Group II strains through horizontal gene transfer. While UbiB isn't specifically mentioned among the differentially present genes, regulatory elements affecting its expression could differ between groups.

    For researchers investigating potential UbiB variations, comparative genomic analysis focusing on the UbiB coding region and its regulatory elements would be necessary to identify group-specific differences that might correlate with host specificity patterns .

  • What methods can detect viable A. citrulli in seed samples for research on UbiB expression?

    For research requiring viable A. citrulli isolates from seed samples to study UbiB expression, several validated detection methods are available:

    Sweat Box Grow-Out Method:

    • Seeds are placed in high humidity chambers at 28°C

    • Symptomatic seedlings are collected at 14 days after planting

    • Confirmation of A. citrulli is done via bioassay

    • Specificity testing has validated this method for detecting different A. citrulli strains

    PMA-qPCR Method:

    • Uses propidium monoazide (PMA) with real-time PCR

    • Selectively detects viable cells by preventing amplification of DNA from dead cells

    • Detection threshold of 10³ CFU/mL in seed samples

    • Primers and TaqMan probe target the A. citrulli genome (Aave_1909)

    Seed Extract qPCR Pre-screening:

    • Can be used before grow-out tests for faster preliminary results

    • Positive results should be confirmed with bioassays

    These methods ensure researchers can isolate viable bacteria for protein expression studies or in vivo analysis of UbiB function .

Intermediate Research Questions

  • How can UbiB function be assessed in the context of A. citrulli pathogenicity?

    To assess UbiB function in relation to A. citrulli pathogenicity, researchers should employ a multi-faceted approach:

    Genetic manipulation:

    • Generate ubiB knockout or knockdown mutants using homologous recombination or CRISPR-Cas systems

    • Create complemented strains to confirm phenotypes are due to UbiB disruption

    • Develop conditional expression systems to study UbiB function at different infection stages

    Pathogenicity assays:

    • Leaf infiltration assays: Compare wild-type and mutant strains (methodology as described in search result )

    • Seed transmission assays: Assess the ability of mutants to establish seed infection

    • Seedling blight assessments: Quantify disease severity using established rating scales

    Metabolic analysis:

    • Measure ubiquinone levels in wild-type and mutant strains using HPLC

    • Assess respiratory capacity using oxygen consumption measurements

    • Evaluate tolerance to oxidative stress conditions commonly encountered during infection

    Comparative transcriptomics:

    • RNA-Seq analysis comparing gene expression patterns between wild-type and ubiB mutants

    • Focus on virulence-related genes, especially those associated with Type III (T3SS) and Type VI (T6SS) secretion systems that are critical for A. citrulli pathogenicity

  • What methods can be used to study UbiB interactions with other proteins in the ubiquinone biosynthesis pathway?

    To elucidate UbiB's protein-protein interactions within the ubiquinone biosynthesis pathway, researchers should consider these methodological approaches:

    Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged recombinant UbiB

    • Identify co-precipitating proteins by mass spectrometry

    • Verify interactions with Western blot using antibodies against suspected partners

    Bacterial two-hybrid system:

    • Fuse UbiB to one domain of a split transcription factor

    • Create a library of A. citrulli proteins fused to the complementary domain

    • Screen for interaction-dependent reporter gene activation

    Proximity-based labeling:

    • Fuse UbiB to biotin ligase (BioID) or APEX2

    • Express in A. citrulli to biotinylate proteins in close proximity to UbiB

    • Purify biotinylated proteins and identify by mass spectrometry

    Surface plasmon resonance:

    • Immobilize purified UbiB on a sensor chip

    • Measure binding kinetics with potential interaction partners

    • Determine association and dissociation rates, and binding affinities

    Fluorescence resonance energy transfer (FRET):

    • Create fusion proteins with UbiB and candidate partners linked to fluorescent proteins

    • Express in A. citrulli and measure energy transfer as indication of interaction

    • Use acceptor photobleaching to confirm specific interactions

    These approaches would help construct the interaction network of UbiB within the ubiquinone biosynthesis pathway and potentially identify novel regulatory mechanisms .

  • How does the plasmid presence in Group I strains affect UbiB expression or function?

    The discovery of a ~53 kb plasmid (pACM6) in Group I strains of A. citrulli provides an interesting context for investigating potential effects on UbiB expression or function:

    Plasmid characteristics and distribution:

    • pACM6 contains 63 open reading frames (55.6% encoding hypothetical proteins)

    • It includes genes for type IV secretion components and a Fic-VbhA toxin-antitoxin module

    • Present in several Group I strains but absent in all tested Group II strains

    • Occurs at low copy numbers (~4.1 ± 1.3 chromosome equivalents) in A. citrulli M6

    Research approaches:

    • Comparative expression analysis: Compare UbiB expression levels between plasmid-containing strains and plasmid-cured derivatives (such as the M6-PC strains described in search result )

    • Regulatory element identification: Analyze if any plasmid-encoded transcription factors influence ubiB expression

    • Metabolic profiling: Measure ubiquinone levels in plasmid-containing versus plasmid-cured strains

    • Functional complementation: Test if introducing the plasmid into Group II strains affects UbiB expression or function

    Experimental methodology:

    • Use qPCR to quantify ubiB transcript levels

    • Employ Western blotting with anti-UbiB antibodies to assess protein levels

    • Conduct reporter gene assays using the ubiB promoter

    • Analyze ubiquinone production using HPLC or LC-MS

    While virulence assays showed the loss of pACM6 did not affect the virulence of A. citrulli M6 under the tested conditions, subtle effects on metabolic functions like ubiquinone biosynthesis might still exist and require more sensitive detection methods .

  • What are the methodological considerations for measuring UbiB enzyme kinetics?

    Accurately measuring UbiB enzyme kinetics requires careful experimental design:

    Protein preparation:

    • Express recombinant UbiB with an N-terminal His-tag as described in search result

    • Purify to >90% homogeneity using immobilized metal affinity chromatography

    • Confirm protein integrity by SDS-PAGE and Western blot

    • Determine protein concentration by Bradford assay or BCA method

    Kinetic assay setup:

    • Substrate preparation: Synthesize or commercially obtain 2-octaprenylphenol (the likely substrate)

    • Buffer optimization: Test different pH values (typically 7.0-8.0) and ionic strengths

    • Cofactor requirements: Include ATP (1-5 mM) and divalent cations (Mg²⁺ or Mn²⁺, 5-10 mM)

    • Reaction conditions: Optimize temperature (typically 25-37°C) and reaction time

    Measurement methods:

    ParameterMethodDetection LimitAdvantages
    ATP consumptionLuciferase-based assay10-100 nM ATPHigh sensitivity, real-time
    Phosphate releaseMalachite green assay0.1-1 μM PiSimple, colorimetric
    Product formationHPLC-UV0.1-1 μM productDirect product detection
    Product formationLC-MS/MS1-10 nM productHigh specificity, structural confirmation

    Data analysis:

    • Calculate initial reaction velocities at various substrate concentrations

    • Fit data to Michaelis-Menten equation to determine Km and Vmax

    • Consider alternative models if data shows cooperativity or substrate inhibition

    • Validate findings with appropriate statistical analysis

    Inhibition studies:

    • Test known ubiquinone biosynthesis inhibitors

    • Determine inhibition constants (Ki) and inhibition mechanisms

    • Use thermal shift assays to confirm direct binding of inhibitors

    These methodological considerations would ensure reliable and reproducible kinetic data for A. citrulli UbiB .

  • How does temperature affect UbiB stability and function in the context of A. citrulli pathogenicity?

    Temperature is a critical factor affecting both protein stability and bacterial pathogenicity. For UbiB research, consider these methodological approaches:

    Protein stability analysis:

    • Thermal shift assays: Measure protein unfolding transitions at different temperatures

    • Circular dichroism: Monitor secondary structure changes with temperature

    • Limited proteolysis: Assess structural integrity after temperature treatments

    • Activity assays: Compare enzymatic activity after different temperature exposures

    Expression analysis:

    • qRT-PCR: Quantify ubiB transcript levels at different growth temperatures

    • Western blot: Measure UbiB protein levels under various temperature conditions

    Pathogenicity correlation:

    • Infiltration assays: Compare wild-type and ubiB mutant virulence at different temperatures

    • Growth curves: Monitor bacterial growth rates at temperatures ranging from 20-40°C

    • Seed transmission: Assess efficiency at different incubation temperatures

    Experimental data from A. citrulli research:

    TemperatureObservationRelevance to UbiB Research
    28°COptimal for growth-out assays and symptom developmentStandard condition for pathogenicity assays
    41°CUsed in plasmid curing experimentsPotential effect on UbiB expression and function
    66-67°CThermal inactivation point for bacteriophages against A. citrulliUpper limit for protein stability studies
    pH 5-9Stability range for bacteriophagesOptimal pH range for UbiB assays

    Temperature-related research is particularly important as climate change may alter the temperature ranges encountered by A. citrulli in agricultural settings, potentially affecting the role of UbiB in pathogenicity and bacterial survival .

Advanced Research Questions

  • How can site-directed mutagenesis of UbiB reveal structure-function relationships in A. citrulli?

    Site-directed mutagenesis provides powerful insights into structure-function relationships of UbiB. For A. citrulli UbiB research, consider this comprehensive approach:

    Target residue selection:

    • ATP-binding residues: Based on the amino acid sequence (positions with conserved glycine-rich motifs)

    • Catalytic residues: Conserved aspartate, histidine, or serine residues

    • Substrate binding sites: Hydrophobic residues likely to interact with the prenyl chain

    • Membrane interaction domains: Hydrophobic patches or amphipathic helices

    Mutation design strategy:

    Mutation TypeExamplePurpose
    ConservativeD→E, K→RTest importance of charge while maintaining chemical properties
    Non-conservativeD→A, K→ACompletely remove side chain functionality
    Introduction of bulkA→W, G→FTest spatial constraints in binding pockets
    Charge reversalD→K, K→ETest electrostatic interactions
    Cysteine substitutionX→CEnable disulfide crosslinking or chemical modification

    Functional assessment matrix:

    AssayWild-type UbiBActive Site MutantSubstrate Binding MutantRegulatory Site Mutant
    ATP binding+++++++++
    Substrate binding++++++++++
    Catalytic activity++++++++
    In vivo complementation+++-+/-+
    Temperature stability++++++++/-

    Expression and purification protocol:

    1. Clone wild-type and mutant ubiB genes into pET-based vectors with N-terminal His-tags

    2. Express in E. coli BL21(DE3) at 18°C overnight after IPTG induction

    3. Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

    4. Verify protein folding using circular dichroism spectroscopy

    5. Store in Tris/PBS buffer with 6% Trehalose at pH 8.0 as recommended in search result

    The systematic mutational analysis would provide crucial insights into which residues and domains are essential for UbiB function in A. citrulli .

  • How might UbiB contribute to A. citrulli's host specificity between Group I and Group II strains?

    The distinct host preferences between Group I (melon-associated) and Group II (watermelon-associated) A. citrulli strains raise intriguing questions about UbiB's potential role in host specificity:

    Genetic comparison approach:

    • Sequence UbiB from multiple Group I and II strains to identify consistent polymorphisms

    • Analyze regulatory regions for differences in expression control

    • Examine potential post-translational modifications specific to each group

    Expression analysis during host interaction:

    Experimental ConditionMeasurementExpected Outcome if UbiB Affects Host Specificity
    Group I strain on melonUbiB expressionUpregulation compared to watermelon infection
    Group I strain on watermelonUbiB expressionLower or altered expression pattern
    Group II strain on watermelonUbiB expressionUpregulation compared to melon infection
    Group II strain on melonUbiB expressionLower or altered expression pattern

    Functional exchange experiments:

    1. Create chimeric strains by replacing the UbiB gene in Group I strain with that from Group II and vice versa

    2. Assess virulence and fitness on different host plants

    3. Measure ubiquinone production in each chimeric strain during infection

    Host environment adaptation:

    • Test UbiB activity in the presence of host-specific antimicrobial compounds

    • Analyze respiratory efficiency in different host tissue extracts

    • Examine resistance to oxidative stress typical of different host defense responses

    Integration with other virulence mechanisms:

    • Investigate interactions between UbiB and Type III secretion system (T3SS) components

    • Examine if UbiB function affects the expression or secretion of effectors like AopU, which has been shown to interfere with plant immune responses as described in search result

    • Analyze potential cross-talk with the Type VI secretion system (T6SS), which plays a role in interspecies competition but not direct virulence as noted in search results

    These approaches would help determine if UbiB plays a direct or indirect role in the host specificity differences observed between Group I and Group II strains .

  • What role might UbiB play in A. citrulli seed transmission and long-term survival?

    The ability of A. citrulli to survive in seeds for extended periods is critical to its epidemiology. Investigating UbiB's role in seed transmission requires specialized methodological approaches:

    Long-term survival assessment:

    • Create ubiB knockout and complemented strains

    • Inoculate seeds with these strains using established methods

    • Store seeds under different conditions (temperature, humidity)

    • Periodically assess bacterial viability over months to years

    • Compare survival rates between wild-type and mutant strains

    Seed localization studies:

    • Use fluorescently tagged wild-type and ubiB mutant strains

    • Track bacterial movement using confocal microscopy

    • Determine if UbiB affects localization to critical seed structures

    • Assess the relationship between embryo localization and UbiB function

    Physiological adaptation mechanisms:

    Seed Environment FactorUbiB-Related ResponseMeasurement Method
    DesiccationAltered ubiquinone productionHPLC analysis of ubiquinone content
    Nutrient limitationMetabolic adaptationRespirometry, ATP measurements
    Seed antimicrobialsResistance mechanismsSurvival assays with seed extracts
    Dormancy conditionsPersister cell formationTranscriptomics of persister population

    Seed treatment challenges:

    • Test sensitivity of wild-type vs. ubiB mutants to:

      • Chlorine gas treatments

      • Peroxyacetic acid seed treatments

      • Other commercial seed disinfectants

    • Determine if UbiB contributes to treatment resistance

    Contextual information from research data:

    • A. citrulli has been observed to survive for >34 years in stored watermelon seeds

    • Embryo localization enhances survival during seed disinfection treatments

    • Seed treatments with peroxyacetic acid or chlorine gas have variable efficacy depending on bacterial localization

    Understanding UbiB's contribution to seed survival would provide insights into potential targeted approaches for improving seed treatment efficacy against this important seedborne pathogen .

  • How might UbiB function interface with Type III and Type VI secretion systems in A. citrulli?

    Recent research has highlighted the importance of Type III (T3SS) and Type VI (T6SS) secretion systems in A. citrulli pathogenicity and interspecies competition. Investigating UbiB's relationship with these systems requires sophisticated experimental approaches:

    Energy dependency analysis:

    Secretion SystemEnergy RequirementPotential UbiB Impact
    T3SSATP-dependentDirect energy supply through respiratory chain
    T6SSProton motive forceMembrane potential maintenance

    Experimental methodology matrix:

    Research QuestionApproachExpected Results If UbiB Interfaces With Secretion Systems
    Does UbiB affect T3SS function?Compare effector secretion in wild-type vs. ubiB mutantsReduced effector secretion in mutants
    Does UbiB contribute to T6SS activity?Bacterial competition assays with ubiB mutantsDecreased competitive ability
    Is UbiB expression coordinated with secretion systems?Transcriptomics under infection conditionsCo-regulation patterns
    Does ATP limitation affect systems differently?Growth in respiratory inhibitorsDifferential effects on T3SS vs. T6SS

    Integration with known A. citrulli pathogenicity mechanisms:

    1. Examine if UbiB-dependent energy production affects the secretion of AopU (a T3SS effector described in search result )

    2. Investigate if UbiB function influences the T6SS-mediated competition against other bacteria in the plant environment (as described in search results )

    3. Determine if metabolic adaptation mediated by UbiB affects the expression or assembly of these complex secretion systems

    Structural biology approach:

    • Investigate potential protein-protein interactions between UbiB and components of secretion systems

    • Map the cellular localization of UbiB in relation to T3SS and T6SS machinery

    • Assess if membrane domains of UbiB are proximal to secretion system apparatus

    This research would provide valuable insights into how basic metabolic functions like ubiquinone biosynthesis integrate with specialized virulence mechanisms in plant pathogenic bacteria .

  • What are the critical considerations for developing UbiB inhibitors as potential antimicrobials against A. citrulli?

    Developing UbiB inhibitors as novel antimicrobials against A. citrulli requires a comprehensive drug discovery pipeline with several critical considerations:

    Target validation:

    • Confirm essentiality of UbiB for growth and virulence under agricultural conditions

    • Demonstrate that chemical inhibition phenocopies genetic deletion

    • Assess potential for resistance development

    • Evaluate effects on non-target beneficial organisms

    Structure-based drug design workflow:

    StageMethodologyConsiderations Specific to A. citrulli
    Structure determinationHomology modeling using UbiB sequence from search result Accuracy of models without experimental structures
    Binding site identificationComputational prediction of druggable pocketsFocus on ATP-binding and catalytic sites
    Virtual screeningMolecular docking of compound librariesSpecificity for A. citrulli vs. plant UbiB homologs
    Hit validationBiochemical assays with recombinant proteinExpression system described in search result
    Lead optimizationMedicinal chemistryAgricultural application requirements
    In vivo testingGreenhouse and field trialsSeed treatment vs. foliar application

    Agricultural application requirements:

    • Formulation stability: Under variable field conditions

    • UV resistance: For foliar applications

    • Rainfastness: To prevent washing off

    • Seed compatibility: For seed treatment applications

    • Environmental impact: Biodegradability and ecotoxicology

    • Regulatory considerations: Safety profile for approval

    Delivery system optimization:

    Delivery MethodAdvantagesChallenges
    Seed treatmentDirect protection of seedlingsLimited systemic activity
    Foliar sprayDirect contact with bacteriaEnvironmental exposure
    Soil drenchPotential systemic uptakeSoil adsorption
    Transgenic expression of inhibitory peptidesContinuous protectionRegulatory hurdles

    Integration with existing management strategies:

    • Compatibility with cultural practices for BFB management

    • Potential for synergy with bacteriophage treatments described in search results

    • Integration with seed testing protocols to target treatment to infected seed lots

    This comprehensive approach would maximize the potential for developing effective UbiB-targeted antimicrobials while addressing the practical constraints of agricultural application .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.