Recombinant Acidovorax citrulli Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme in Gram-negative bacteria responsible for the first step in lipoprotein biogenesis. It catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, forming a thioether bond critical for membrane localization and stability . In Acidovorax citrulli, a plant pathogen causing bacterial fruit blotch, Lgt is likely integral to virulence, as lipoproteins are often involved in pathogenicity, motility, and stress adaptation .

Key Features of Lgt in Acidovorax citrulli

Role in Pathogenicity

Lipoproteins modified by Lgt in A. citrulli may contribute to:

  • Outer Membrane Integrity: Preventing permeabilization under stress .

  • Virulence Factors: Regulating secretion systems (e.g., type III secretion system) or biofilm formation .

Functional Implications

  • Essentiality: Deletion of lgt in E. coli is lethal, implying a critical role in membrane biogenesis . In A. citrulli, Lgt may be essential for pathogen survival and virulence.

  • Regulatory Interactions: In P. citrulli, ClpA protease regulates RepA, which modulates biofilm formation and T3SS genes . While not directly linked to Lgt, such regulatory networks highlight the interconnectedness of bacterial virulence factors.

Table 1: Key Conserved Residues in Lgt

ResidueRole in E. coli LgtConservation in A. citrulli Lgt
Y26Critical for catalysisLikely conserved
N146Substrate bindingLikely conserved
G154Structural stabilityLikely conserved
R143Phosphatidylglycerol bindingLikely conserved
R239Prolipoprotein interactionLikely conserved

Table 2: Recombinant Lgt Applications

ApplicationDetails
ELISADetection of anti-Lgt antibodies in research or diagnostics
Biochemical StudiesEnzyme activity assays (e.g., glycerol phosphate release)
Antibacterial Drug DevelopmentTarget validation for inhibitors disrupting lipoprotein biosynthesis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
lgt; Aave_1509; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
lgt
Target Protein Sequence
MLMYPHIDPIALQIGPLAIHWYGLTYLAAFGLFMFLGTRRLRHEPYASLTGAQAWTRKDV EDILFLGVLGVVVGGRLGYCLFYKPGYYLSHPLEIFYIWQGGMSFHGGLLGVIASMVWFA RSRHRPWLQVADFVAPCVPTGLAAGRVGNFINGELWGRFCDPSLPWGMVFPQSGSMLPRH PSQVYQFLMEGLLLFVLLWLYARRERRQGEVAAAFLVGYGCFRFIAEYFREPDAFLGILS LGMSMGQWLCVPMIVAGVLLWVWARRQPAR
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (Lgt) in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first essential step in bacterial lipoprotein biosynthesis. The enzyme transfers a diacylglyceryl group, derived from phosphatidylglycerol, to the sulfhydryl group of the conserved cysteine (Cys+1) in the lipobox motif of preprolipoproteins as they exit the Sec or Tat translocon. This modification results in the formation of a thioether-linked diacylglyceryl-prolipoprotein, with glycerolphosphate as a by-product . This initial lipidation step is critical for subsequent processing by signal peptidase II (Lsp) and potentially N-acyltransferase (Lnt), ultimately resulting in membrane anchoring of lipoproteins .

How should recombinant Acidovorax citrulli Lgt be stored and handled for optimal stability?

For optimal stability and activity preservation, recombinant Acidovorax citrulli Lgt should be stored in Tris-based buffer with 50% glycerol at -20°C. For extended storage periods, -80°C is recommended . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and enzymatic activity . When handling the protein for experimental purposes, it's advisable to maintain cold chain conditions and minimize exposure to extreme pH conditions that might denature the membrane protein. The addition of glycerol serves as a cryoprotectant that helps maintain the native conformation of the protein during freezing and thawing processes.

What approaches are most effective for expressing and purifying functional recombinant Lgt?

Expression and purification of functional recombinant Lgt presents significant challenges due to its integral membrane nature. Based on experimental approaches with similar proteins, the following methodology is recommended:

Expression System Selection:

  • Bacterial expression systems (particularly E. coli) with tight regulation are preferable

  • For Acidovorax citrulli Lgt, codon optimization may be necessary when expressing in heterologous hosts

  • Expression constructs should include appropriate affinity tags (His-tag or Myc-tag) positioned to avoid interference with the active site

Membrane Protein Solubilization:

  • Gentle detergents such as dodecyl maltoside (DDM) have proven effective for Lgt solubilization while maintaining enzymatic activity

  • A two-phase extraction system using chloroform:methanol (2:1) can be employed for selective extraction of lipidated peptides

Activity Preservation:

  • Addition of phospholipids during purification helps maintain the native environment

  • Purification buffers should contain glycerol (typically 10-20%) to stabilize the protein

  • Consider using inverted vesicles for extraction, as Lgt has shown extraction capability with water or low ionic strength solutions

What assays can be used to evaluate the enzymatic activity of recombinant Acidovorax citrulli Lgt?

Several complementary approaches can be employed to assess Lgt enzymatic activity:

Paper Electrophoretic Assay:
This direct, accurate, and relatively simple method has been newly designed for Lgt activity measurement. The assay separates reaction products based on their charge differences and allows for quantitative assessment of enzymatic activity . The method is particularly valuable for kinetic studies of solubilized enzyme preparations.

Synthetic Peptide-Substrate Approach:
Using synthetic peptides containing the lipobox motif (like MKATKSAVGSTLAGCSSHHHHHH) as substrates provides a controlled system for analyzing Lgt specificity and activity . This approach has revealed that Lgt lacks substrate preference based on hydrophobicity, which explains the enzyme's ability to modify lipoproteins with diverse signal peptides .

Complementation Assays:
For functional validation, genetic complementation using Lgt variants in an lgt depletion strain provides valuable insights into the importance of specific amino acid residues. The methodology involves:

  • Transforming Lgt variants into appropriate depletion strains

  • Selecting transformants on medium containing appropriate antibiotics and inducers

  • Restreaking isolated colonies on plates with and without inducers

  • Analyzing growth restoration as an indicator of functional complementation

Mass Spectrometry Analysis:
MALDI-TOF mass spectrometry can be used to detect lipid modifications on target peptides, providing direct evidence of Lgt activity. Specialized extraction protocols using detergents and organic solvents improve the detection of lipidated peptides .

How can site-directed mutagenesis be effectively applied to study structure-function relationships in Lgt?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in Lgt. Based on established methodologies:

Target Selection Strategy:

  • Focus on highly conserved residues identified through multiple sequence alignments of Lgt from various bacterial species

  • Prioritize invariant residues within the Lgt signature motif

  • Consider residues in predicted transmembrane segments and cytoplasmic/periplasmic loops

Mutagenesis Protocol:
The Quick-Change site-directed mutagenesis protocol has been successfully applied for Lgt studies. This two-step PCR approach requires:

  • Design of complementary synthetic oligonucleotides containing the desired mutations

  • PCR amplification using a high-fidelity polymerase

  • DpnI digestion to eliminate template DNA

  • Transformation into competent cells

Functional Evaluation:
Mutant Lgt variants should be evaluated through:

  • Complementation assays in Lgt-depleted strains

  • In vitro activity assays using synthetic substrates

  • Membrane localization analysis to ensure proper protein folding and insertion

Previous research has identified several critical residues for Lgt function, including Y26, N146, and G154, which are absolutely required, and R143, E151, R239, and E243, which are important but not essential . Similar approaches can be applied to Acidovorax citrulli Lgt to identify its critical functional residues.

How does the membrane topology of Lgt influence its enzymatic mechanism?

The membrane topology of Lgt plays a crucial role in its enzymatic function through strategic positioning of catalytic residues and substrate access. Studies on E. coli Lgt using substituted cysteine accessibility method (SCAM) have demonstrated that the enzyme contains seven transmembrane segments with its N-terminus facing the periplasm and C-terminus in the cytoplasm . This orientation positions the critical Lgt signature motif toward the periplasmic side, where it can interact with emerging preprolipoproteins as they exit the Sec or Tat translocon.

Interestingly, contradictory evidence from solubilization experiments suggests a peripheral and possibly reversible hydrophobic association of Lgt with the inner membrane on the cytosolic side . This apparent discrepancy raises important questions about potential dynamic changes in Lgt topology during the catalytic cycle or different topological arrangements in different bacterial species.

Research methodologies to further explore this relationship should include:

  • Topology mapping using reporter fusions

  • Crosslinking studies to identify substrate interaction sites

  • Molecular dynamics simulations to model conformational changes during catalysis

How do environmental conditions affect Lgt activity and what are the implications for bacterial adaptation?

The environmental modulation of Lgt activity represents an important but understudied aspect of bacterial adaptation. Several factors likely influence Lgt function:

Temperature Effects:
Heat stability has been noted as a distinguishing characteristic between soluble and membrane-bound Lgt forms . For Acidovorax citrulli, a plant pathogen that must adapt to varying environmental temperatures, the thermal range of Lgt activity may be broader than for host-restricted pathogens. Research should examine activity profiles across temperature ranges relevant to plant infection cycles (typically 15-35°C).

Membrane Fluidity and Composition:
Changes in environmental conditions alter bacterial membrane composition, which may affect:

  • Accessibility of phosphatidylglycerol substrate to Lgt

  • Proper embedding of Lgt transmembrane segments

  • Interaction with lipoprotein substrates

pH Dependence:
The periplasmic and cytoplasmic pH can fluctuate based on environmental conditions. Since the Lgt active site appears to span the membrane with critical residues potentially exposed to different compartments, pH changes may significantly impact catalytic efficiency. Activity assays across physiologically relevant pH ranges would elucidate these effects.

Oxidative Stress Response:
Many bacterial lipoproteins function in stress response pathways. Under oxidative stress, alterations in Lgt activity could affect the processing of these protective proteins. The presence of potentially oxidation-sensitive residues (like cysteines) in Lgt suggests possible redox regulation of its activity.

Methodology for investigating these relationships should include:

  • Activity assays under varying environmental conditions

  • Membrane composition analysis in correlation with Lgt activity

  • In vivo lipoprotein processing studies under stress conditions

How conserved is Lgt across different bacterial species and what does this reveal about its evolutionary importance?

Prolipoprotein diacylglyceryl transferase (Lgt) exhibits significant conservation across bacterial species, highlighting its evolutionary importance in bacterial physiology. Comparative genomic analysis reveals:

Signature Motif Conservation:
The Lgt signature motif contains four invariant residues that are conserved across both Gram-negative and Gram-positive bacteria . This extraordinary conservation suggests these residues play critical roles in the catalytic mechanism or structural integrity of the enzyme.

Essential vs. Non-essential Nature:
Interestingly, while lgt has traditionally been considered essential in Gram-negative bacteria, studies in Corynebacterium glutamicum (a high-GC Gram-positive bacterium) demonstrated that the gene is not essential in this species . This suggests evolutionary divergence in lipoprotein processing pathways between different bacterial lineages.

Functional Residue Conservation:
Site-directed mutagenesis studies in E. coli identified residues Y26, N146, and G154 as absolutely required for Lgt function, while R143, E151, R239, and E243 are important but not essential . Analysis of these positions in Acidovorax citrulli Lgt would reveal whether the same functional constraints apply across different bacterial genera.

Topological Conservation:
The predicted seven-transmembrane topology appears consistent across multiple bacterial species, although experimental verification has been limited to few model organisms . Comparative topology predictions for Lgt proteins across diverse bacteria would illuminate structural conservation patterns.

Research methodologies to further explore evolutionary aspects include:

  • Phylogenetic analysis of Lgt sequences across bacterial phyla

  • Cross-species complementation studies

  • Comparative analysis of lipoprotein processing pathways

What are the consequences of Lgt inactivation in different bacterial species and what does this reveal about lipoprotein functions?

The consequences of Lgt inactivation vary significantly between bacterial species, providing valuable insights into lipoprotein functions and processing pathways:

In Gram-negative Bacteria:
Lgt has traditionally been considered essential in most Gram-negative bacteria, with inactivation resulting in severe growth defects or lethality . This suggests that properly processed lipoproteins perform critical functions in cellular processes like cell envelope integrity and nutrient acquisition.

In Gram-positive Bacteria:
Studies in Corynebacterium glutamicum revealed that lgt is not essential in this species . In lgt deletion strains:

  • Non-acylated lipoproteins are released into the culture supernatant

  • This phenotype is similar to observations in other high-GC Gram-positive bacteria

  • The dependence on protein diacylation and/or LspA for signal sequence cleavage varies between different protein targets

Implications for Lipoprotein Processing:
The observation that acylation is not required for glycosylation in Corynebacteriales lipoproteins challenges the conventional view of a strictly ordered post-translational modification pathway . This suggests multiple parallel or alternative processing routes for lipoproteins in some bacterial species.

For Acidovorax citrulli, researchers should investigate:

  • Whether Lgt is essential for viability

  • The fate of unprocessed prelipoproteins in Lgt-deficient strains

  • Potential compensatory mechanisms that might exist for lipoprotein membrane association

How does understanding Lgt function contribute to antimicrobial development strategies?

Prolipoprotein diacylglyceryl transferase (Lgt) represents a promising target for antimicrobial development due to several key attributes:

Essential Function in Many Pathogens:
The essential nature of Lgt in numerous bacterial pathogens, particularly Gram-negative species, makes it an attractive target for antibiotics with potentially broad-spectrum activity . Inhibition would disrupt multiple cellular processes dependent on properly processed lipoproteins.

Unique Bacterial Process:
Lipoprotein processing has no direct counterpart in eukaryotic cells, potentially allowing for selective targeting with minimal host toxicity. The diacylglyceryl transfer catalyzed by Lgt represents a biochemical reaction unique to bacteria.

Surface Accessibility:
The periplasmic orientation of the Lgt signature motif in Gram-negative bacteria potentially allows for targeting by compounds that need not fully penetrate the inner membrane . This accessibility advantage could facilitate drug design efforts.

Resistance Considerations:
The high conservation of critical residues suggests that resistance-conferring mutations might substantially impair enzyme function, potentially reducing the rapid emergence of resistant strains.

Research strategies for antimicrobial development should include:

  • High-throughput screening assays using the paper electrophoretic method

  • Structure-based drug design targeting the conserved active site

  • Peptide-based inhibitors mimicking the lipobox motif

  • Species-specific targeting strategies based on subtle differences in substrate recognition

What are the major challenges in studying Lgt and how can they be overcome?

Research on Prolipoprotein diacylglyceryl transferase (Lgt) faces several significant technical challenges that require specialized approaches:

Membrane Protein Expression and Purification:
As an integral membrane protein, Lgt is notoriously difficult to express and purify in functional form. Solutions include:

  • Using specialized expression systems designed for membrane proteins

  • Optimizing detergent selection for solubilization (dodecyl maltoside has shown success)

  • Employing fusion tags that enhance solubility while maintaining activity

  • Considering nanodiscs or amphipols as alternatives to detergent micelles

Activity Assay Complexity:
Traditional assays for Lgt activity have been cumbersome and difficult to standardize. The recently developed paper electrophoretic assay offers a direct, more accurate, precise, and easier alternative that could facilitate high-throughput screening . Additional approaches include:

  • Fluorescence-based assays using labeled substrate peptides

  • MS-based detection of lipidated products

  • In vivo reporter systems for functional studies

Structural Characterization:
Obtaining high-resolution structural information remains challenging. Potential strategies include:

  • Cryo-electron microscopy of purified protein in nanodiscs

  • X-ray crystallography using lipidic cubic phase crystallization

  • Integrative structural biology combining multiple low-resolution techniques

Species-Specific Variations:
Extrapolating findings from model organisms to Acidovorax citrulli requires careful consideration. Researchers should:

  • Confirm key findings directly in A. citrulli when possible

  • Use comparative genomics to identify conserved features

  • Employ heterologous expression systems for functional validation

How can researchers effectively analyze the lipidation state of proteins processed by Lgt?

Accurate analysis of protein lipidation states is crucial for validating Lgt function. Several complementary methodologies offer reliable approaches:

Mass Spectrometry-Based Detection:
Mass spectrometry provides the most definitive evidence of lipidation. Effective protocols include:

  • Specialized extraction procedures using dodecyl maltoside followed by chloroform:methanol (2:1) extraction to isolate lipidated peptides

  • MALDI-TOF analysis using 2,5-dihydroxybenzoic acid matrix (20 mg/ml, 50% ACN, 0.1% TFA)

  • LC-MS/MS analysis with precursor ion scanning for lipid-specific fragments

Gel Mobility Shift Assays:
Lipidated proteins often display altered mobility in SDS-PAGE compared to their non-lipidated counterparts. This simple approach can provide initial evidence of modification status.

Metabolic Labeling:
Incorporation of radioactive or modified fatty acid precursors can facilitate detection of lipidated proteins through:

  • Autoradiography following protein separation

  • Click chemistry-based detection using azide-modified fatty acids

  • Selective enrichment of labeled proteins

Subcellular Fractionation:
The membrane association of properly lipidated proteins provides an indirect measure of Lgt function:

  • Properly lipidated proteins partition with membrane fractions

  • In lgt mutant strains, unprocessed lipoproteins may be released into the culture supernatant

  • Quantification of protein distribution between membrane and soluble fractions can indicate lipidation efficiency

Complementation Assays:
Functional restoration in lgt depletion strains provides evidence of proper lipoprotein processing . Complementation success can be quantified through:

  • Growth curve analysis

  • Colony formation efficiency

  • Reporter gene expression linked to lipoprotein function

How should researchers interpret contradictory findings regarding Lgt topology and localization?

The contradictory findings regarding Lgt topology and localization present a significant interpretive challenge that requires careful analysis:

Conflicting Observations:

Interpretive Framework:
When analyzing these contradictions, researchers should consider:

Species-Specific Differences:

  • Different bacterial species may have evolved variations in Lgt topology

  • Membrane composition differences could affect protein embedding

  • Sequence divergence might result in alternative folding patterns

Dynamic Topology Models:

  • Lgt may adopt different conformations during its catalytic cycle

  • The "peripheral association" might represent a specific functional state

  • Reversible membrane association could facilitate interaction with substrates

Methodological Considerations:

  • Different experimental approaches may capture different aspects of Lgt behavior

  • SCAM analyses static topology in the native membrane

  • Solubilization experiments may alter native conformation

Reconciliation Strategies:

  • Perform multiple topology mapping approaches in the same species

  • Use in situ crosslinking to capture native interactions

  • Employ dynamic techniques that can detect conformational changes

  • Develop computational models that account for multiple conformational states

What statistical approaches are appropriate for analyzing Lgt enzymatic activity data?

Robust statistical analysis of Lgt enzymatic activity data requires careful consideration of the assay characteristics and experimental design:

Kinetic Parameter Determination:
For enzyme kinetic studies using the paper electrophoretic assay or other quantitative methods:

  • Non-linear regression should be used to fit data to appropriate enzyme kinetic models (Michaelis-Menten, allosteric models, etc.)

  • Calculate Km, Vmax, and kcat parameters with 95% confidence intervals

  • Consider global fitting approaches for comparing wild-type and mutant enzymes

Complementation Assay Analysis:
For growth-based complementation assays:

  • Area under the curve (AUC) analysis provides a comprehensive measure of growth

  • Time to reach mid-log phase (T50) offers a simple comparative metric

  • Growth rate constants during exponential phase allow for quantitative comparison

  • ANOVA with post-hoc tests (Tukey's or Dunnett's) for multi-group comparisons

Structure-Function Relationships:
When analyzing the effects of mutations:

  • Correlation analysis between biochemical parameters and structural features

  • Principal component analysis to identify patterns in mutational effects

  • Hierarchical clustering to identify functionally similar residues

Environmental Effect Studies:
When examining how environmental conditions affect Lgt activity:

  • Two-way ANOVA to assess interaction between multiple factors

  • Response surface methodology to optimize multiple parameters

  • Time series analysis for studying adaptation processes

Reproducibility Considerations:

  • Report both biological and technical replicates

  • Use appropriate transformations for non-normally distributed data

  • Consider mixed-effects models when combining data from multiple experiments

What emerging technologies could advance our understanding of Lgt function and mechanism?

Several cutting-edge technologies hold promise for elucidating Lgt function and mechanism:

Cryo-Electron Microscopy:
Recent advances in cryo-EM have revolutionized membrane protein structural biology. For Lgt research:

  • Single-particle analysis could reveal the enzyme in different conformational states

  • Tomography could visualize Lgt in its native membrane environment

  • Time-resolved cryo-EM might capture intermediate stages of the catalytic cycle

Native Mass Spectrometry:
This emerging technique allows analysis of intact membrane protein complexes:

  • Characterization of Lgt oligomeric state

  • Detection of stable interactions with substrate proteins

  • Identification of associated lipids that might be important for function

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
HDX-MS could provide insights into Lgt dynamics:

  • Mapping conformational changes upon substrate binding

  • Identifying regions with differential solvent accessibility

  • Detecting allosteric networks within the protein

Single-Molecule Techniques:
Single-molecule approaches could reveal unprecedented details about Lgt function:

  • FRET-based assays to monitor conformational changes

  • Optical tweezers to study force generation during catalysis

  • Super-resolution microscopy to visualize Lgt distribution and dynamics in live cells

Computational Methods:
Advancements in computational biology offer powerful tools:

  • Molecular dynamics simulations of Lgt in lipid bilayers

  • Machine learning approaches for predicting substrate specificity

  • Quantum mechanics/molecular mechanics (QM/MM) modeling of the catalytic mechanism

How might Lgt research contribute to biotechnological applications beyond antimicrobial development?

Beyond antimicrobial development, Lgt research has significant potential for diverse biotechnological applications:

Protein Engineering and Display:
The lipoprotein modification pathway offers unique opportunities for:

  • Development of bacterial surface display systems for protein engineering

  • Creation of anchored enzyme cascades for biotransformation processes

  • Design of self-assembling protein-lipid nanostructures

Vaccine Development:
Lipidated proteins are potent activators of innate immunity:

  • Lgt-based modification systems could generate improved vaccine adjuvants

  • Recombinant lipoproteins could serve as carrier proteins for conjugate vaccines

  • Understanding species-specific Lgt preferences could optimize bacterial vaccine design

Biosensor Development:
Lgt-mediated membrane anchoring could be exploited for:

  • Creation of whole-cell biosensors with surface-displayed recognition elements

  • Development of lipoprotein-based FRET sensors for detecting environmental analytes

  • Engineering bacteria with lipid-anchored antibody fragments for diagnostic applications

Synthetic Biology Tools:
The lipidation pathway represents a valuable addition to the synthetic biology toolkit:

  • Orthogonal membrane anchoring systems for synthetic circuit components

  • Controllable protein localization through regulated lipidation

  • Novel genetic parts based on lipoprotein secretion and processing

Biocatalysis Applications:
Enzyme immobilization via lipid anchors offers several advantages:

  • Enhanced stability through membrane association

  • Co-localization of sequential enzymes for improved reaction efficiency

  • Easy recovery through membrane isolation

These diverse applications highlight the broader significance of understanding Lgt function beyond its role as an antimicrobial target.

What are the common pitfalls in Lgt activity assays and how can they be addressed?

Researchers frequently encounter several challenges when assaying Lgt activity. Here are common pitfalls and their solutions:

Low Signal-to-Noise Ratio:

  • Problem: High background or weak signal detection in activity assays
    Solutions:

    • Optimize substrate concentration and enzyme-to-substrate ratio

    • Use longer incubation times for low-activity samples

    • Employ more sensitive detection methods like fluorescence-based assays

    • Ensure proper negative controls to establish true baseline

Detergent Interference:

  • Problem: Detergents used for Lgt solubilization may inhibit activity or interfere with detection
    Solutions:

    • Screen multiple detergents at various concentrations

    • Consider detergent exchange after initial solubilization

    • Use detergent-compatible assay formats

    • Validate with controls containing equivalent detergent concentrations

Substrate Accessibility:

  • Problem: Poor accessibility of peptide substrates to the enzyme active site
    Solutions:

    • Ensure proper substrate design with accessible lipobox motif

    • Consider using shorter peptides for initial studies

    • Validate substrate quality through mass spectrometry

    • Test multiple substrate concentrations to account for potential accessibility issues

Phospholipid Availability:

  • Problem: Limited availability of phosphatidylglycerol donor in reconstituted systems
    Solutions:

    • Supplement reaction with exogenous phosphatidylglycerol

    • Consider using native membrane preparations as a source of lipids

    • Monitor phospholipid content throughout purification process

    • Optimize lipid-to-protein ratio in reconstituted systems

Protein Stability:

  • Problem: Loss of Lgt activity during storage or experimental manipulation
    Solutions:

    • Store protein in 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Maintain cold chain during experimental procedures

    • Consider adding stabilizing agents like specific lipids or mild reducing agents

How can researchers troubleshoot issues with recombinant expression of Acidovorax citrulli Lgt?

Successful recombinant expression of membrane proteins like Acidovorax citrulli Lgt requires addressing several common challenges:

Poor Expression Levels:

  • Problem: Low yield of recombinant Lgt
    Solutions:

    • Optimize codon usage for the expression host

    • Test multiple promoter strengths and induction conditions

    • Consider specialized expression hosts designed for membrane proteins

    • Explore fusion partners that enhance expression (MBP, SUMO, etc.)

Protein Misfolding and Aggregation:

  • Problem: Formation of inclusion bodies or misfolded protein
    Solutions:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration for slower expression

    • Co-express with molecular chaperones

    • Add specific lipids to growth medium

    • Consider refolding protocols if inclusion bodies form

Toxicity to Host Cells:

  • Problem: Growth inhibition upon Lgt expression
    Solutions:

    • Use tightly regulated expression systems

    • Select lower-copy-number vectors

    • Test C41/C43 E. coli strains designed for toxic membrane proteins

    • Implement auto-induction media for gradual protein expression

Inefficient Membrane Integration:

  • Problem: Poor targeting to the membrane
    Solutions:

    • Ensure native signal sequences are intact

    • Consider homologous expression systems

    • Test different fusion tag positions (N- vs C-terminal)

    • Analyze membrane fraction specifically for protein localization

Proteolytic Degradation:

  • Problem: Rapid degradation of expressed protein
    Solutions:

    • Add protease inhibitors during extraction

    • Test protease-deficient expression strains

    • Optimize extraction buffer composition

    • Consider shorter induction times with higher cell density

By systematically addressing these common issues, researchers can significantly improve the yield and quality of recombinant Acidovorax citrulli Lgt for subsequent functional and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.