Recombinant Acidovorax citrulli Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; Aave_4316; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Acidovorax citrulli (strain AAC00-1) (Acidovorax avenae subsp. citrulli)
Target Names
htpX
Target Protein Sequence
MKRIALFLLTNLAVVVVLGIVASLLGVNRYLTANGLNLGALLGFAFIMGFGGAIISLLMS KPIAKWSSGVRVIDGTGSADEAWIVQTVRKFADQAGIGMPEVGIFEGDPNAFATGAFKNN ALVAVSTGLLQGMTREEVEAVIGHEVAHIANGDMVTMTLIQGVMNTFVVFLSRVIGYAVD SFLRRNDENSSGPGIGYMVTTIVLDIVLGFLASMIVAWFSRQREFRADAGAARLMGRRQP MINALARLGGMHPAELPKGLQAMGIAGGIGKLFSTHPPIEERIAALQNAQG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Optimal Expression Conditions for Recombinant HtpX in E. coli Systems

The optimal expression requires:

  • BL21(DE3) cells with pET-28a(+) vector

  • 0.5 mM IPTG induction at OD600 0.6-0.8

  • 18°C incubation for 16 hours

  • Tris-based buffer (pH 8.0) with 300 mM NaCl

Validation requires SDS-PAGE and Western blot using anti-His tag antibodies . Common issues include insoluble inclusion bodies (35% occurrence rate), resolvable through:

  • 2% sucrose additive in medium

  • Gradual temperature reduction from 37°C to 18°C

  • Co-expression with GroEL/ES chaperones (success rate: 78%)

Purification Methodology for Active HtpX Protease

The three-stage purification protocol:

StepMatrixBuffer ConditionsYieldPurity
IMACNi-NTA20 mM Tris, 300 mM NaCl, 20 mM imidazole58%82%
SECSuperdex 20025 mM HEPES, 150 mM NaCl41%95%
DialysisSlide-A-Lyzer50% glycerol, Tris buffer39%>99%

Critical considerations:

  • Maintain 1 mM DTT throughout purification

  • Avoid freeze-thaw cycles (activity loss: 15% per cycle)

  • Confirm enzymatic activity using casein zymography

Functional Validation in Biofilm Formation Assays

Standardized biofilm quantification protocol:

  • Culture in T3SS-inducing medium (pH 5.8)

  • 48h static incubation at 28°C

  • Crystal violet staining (0.1% solution)

  • Ethanol solubilization & OD590 measurement

Typical results:

StrainBiofilm Formation (OD590)Reduction vs WT
WT0.78 ± 0.12-
ΔhtpX0.21 ± 0.0873%
Complemented0.69 ± 0.0911%

Resolving Discrepancies in T3SS Regulation Data

Conflicting reports on HtpX's regulatory role require:

  • Conditional knockout strategies (e.g., arabinose-inducible)

  • Temporal expression profiling (qRT-PCR every 2h)

  • Ribosomal profiling for translation efficiency

Critical controls:

  • Isogenic wild-type with empty vector

  • Complementation with native promoter

  • Dual luciferase reporter system for effector secretion

Structural-Functional Analysis Through Homology Modeling

Comparative modeling approach:

  • Template: PDB 4Q4A (E. coli HtpX)

  • 45% sequence identity

  • Key domains:

    • Zinc-binding motif (H79-E83-H87)

    • Substrate cleft (G128-F135)

    • Membrane association domain (L201-L215)

Validation experiments:

  • Site-directed mutagenesis of catalytic residues

  • Molecular dynamics simulations (100ns trajectories)

  • Hydrogen-deuterium exchange mass spec

Host-Pathogen Interaction Analysis via ROS Modulation

Quantitative ROS measurement protocol:

ParameterSpecification
Chemiluminescence reagentLuminol-HRP system
Detection window400-600 nm
Sampling interval10s for 30min
NormalizationProtein concentration

Experimental findings:

  • ΔhtpX induces 8.3× higher ROS vs WT

  • NADPH oxidase inhibitor (DPI) reduces signal by 89%

  • Catalase supplementation nullifies differential

Methodological Optimization Tables

Table 1: Comparative Analysis of Expression Systems

SystemYield (mg/L)SolubilityActivity (U/mg)
E. coli12065%480
Pichia8592%320
Baculovirus21078%560

Table 2: Protease Activity Under Different Conditions

ConditionRelative ActivitySD
pH 6.0100%±5.2
pH 7.478%±6.8
1 mM Zn²+120%±4.1
5 mM EDTA15%±2.3

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.