Recombinant Acidovorax citrulli UPF0060 membrane protein Aave_2845 (Aave_2845)

What is the amino acid sequence and basic properties of the Aave_2845 protein?

The Aave_2845 protein is a 111-amino acid membrane protein with the following sequence:
MVELKTFLLYAVTALAEIAGCYLPWLWLRQDRSAWLLVPGAACLALFAWLLTLHPAAAGRVYAAYGGVYVAVALGWLWAVDGIRPDRWDLAGAAVTLAGMAIIAFAPRGAA

Analysis of this sequence reveals characteristic features of a membrane protein with hydrophobic regions. The protein has a molecular weight of approximately 12 kDa and contains transmembrane domains typical of membrane-associated proteins. Biochemical characterization indicates it belongs to the UPF0060 family of proteins, which are conserved across various bacterial species but remain functionally uncharacterized in many organisms .

What are the most effective expression systems for producing recombinant Aave_2845?

For membrane proteins like Aave_2845, E. coli expression systems have proven effective, as demonstrated by commercial preparations . The methodological approach involves:

• Cloning the full-length gene sequence (positions 1-111) into an appropriate expression vector

• Adding an N-terminal His-tag for purification purposes

• Transforming into an E. coli expression strain optimized for membrane proteins

• Inducing expression under controlled conditions to prevent aggregation

While E. coli is the most commonly used system, researchers should consider alternative expression systems for specific experimental needs:

What purification challenges are specific to Aave_2845 and how can they be overcome?

As a membrane protein, Aave_2845 presents several purification challenges:

• Solubility issues: Standard approaches include:

  • Using specialized detergents to solubilize the protein from membranes

  • Optimizing buffer conditions to maintain protein stability

  • Employing mild solubilization techniques to preserve native structure

• Purification strategy: The recommended approach utilizes:

  • IMAC (Immobilized Metal Affinity Chromatography) leveraging the His-tag

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

• Quality assessment metrics:

  • Purity >90% as assessed by SDS-PAGE

  • Western blot confirmation of target protein

  • Mass spectrometry to verify protein integrity

What techniques are most suitable for determining the membrane topology of Aave_2845?

Understanding membrane topology is crucial for functional characterization. Recommended methodologies include:

These approaches should be used complementarily, as each has strengths and limitations when applied to membrane proteins.

How does Aave_2845 compare structurally and functionally to homologous proteins in other bacterial pathogens?

Comparative analysis provides insights into potential functions:

• Homology assessment:

  • UPF0060 family proteins are found across multiple bacterial species

  • Sequence alignment reveals conserved regions that may indicate functional domains

  • Structural prediction indicates similar membrane topology across homologs

• Functional inferences:

  • By analogy to other bacterial membrane proteins, Aave_2845 may contribute to membrane integrity, signaling, or transport functions

  • Its conservation suggests importance, though specific roles remain to be characterized

• Evolutionary considerations:

  • Pathogens like A. citrulli have evolved specialized protein arsenals for host infection and colonization

  • Membrane proteins often play roles in adaptation to specific host environments

How might Aave_2845 contribute to the differential host specificity observed between group I and group II A. citrulli strains?

A. citrulli strains show distinct host preferences, with group I strains primarily affecting melon and group II strains being more aggressive on watermelon . While the specific contribution of Aave_2845 has not been directly established, several hypotheses can be considered:

• Potential mechanisms:

  • Membrane proteins may affect bacterial adhesion to specific host tissues

  • They may be involved in sensing environmental cues specific to different host plants

  • They could contribute to resistance against host defense compounds

• Experimental approaches to test these hypotheses:

  • Comparative genomic analysis of Aave_2845 sequences between group I and II strains

  • Knockout/complementation studies to assess virulence changes on different hosts

  • Heterologous expression to determine if the protein confers altered host specificity

What evidence exists for Aave_2845 interaction with the type III secretion system or other virulence mechanisms?

While direct evidence specifically for Aave_2845 is limited in the provided literature, broader research on A. citrulli provides a framework for investigation:

• Type III secretion system context:

  • A. citrulli possesses a complex T3SS regulated by HrpX, an AraC-type transcriptional regulator

  • The pathogen contains at least 58 validated type III-secreted effectors

  • Membrane proteins may interact with or support T3SS function

• Regulatory networks:

  • Genes like barA encode multi-sensor hybrid histidine kinases that regulate virulence

  • These regulatory systems may influence membrane protein expression

  • Transcriptomic studies could reveal co-regulation patterns with known virulence factors

What gene knockout strategies are most effective for studying Aave_2845 function in A. citrulli?

Designing gene knockout studies requires careful consideration:

• Methodological approaches:

  • Homologous recombination with antibiotic resistance cassettes

  • CRISPR-Cas9 systems adapted for bacterial editing

  • Transposon mutagenesis for high-throughput screening

• Validation strategies:

  • PCR confirmation of gene deletion

  • RT-PCR to verify absence of transcript

  • Western blotting to confirm protein absence

  • Complementation studies to confirm phenotype specificity

• Phenotypic assays:

  • Growth curves in various media conditions

  • Biofilm formation assessment

  • Host infection studies on both melon and watermelon

  • Microscopy to evaluate morphological changes

How can researchers design experiments to elucidate potential protein-protein interactions involving Aave_2845?

Understanding protein interactions is crucial for functional characterization:

For membrane proteins like Aave_2845, specialized approaches should be considered:

• Detergent selection is critical for maintaining native interactions

• In-membrane crosslinking prior to solubilization can capture transient interactions

• Proper controls should account for non-specific membrane protein associations

How can researchers resolve contradictory data in Aave_2845 functional studies?

Scientific research often generates seemingly contradictory results. For Aave_2845 studies, consider:

• Sources of experimental variability:

  • Differences in protein expression constructs (tag position, linker sequences)

  • Variation in purification protocols affecting protein conformation

  • Host strain differences in knockout studies

• Resolution strategies:

  • Standardize experimental conditions across laboratories

  • Employ multiple complementary approaches to test the same hypothesis

  • Consider contextual factors like bacterial growth phase and environmental conditions

• Data integration approaches:

  • Meta-analysis of multiple studies

  • Systematic review of methodological differences

  • Bayesian analysis to weight evidence based on methodological strength

What considerations are important when designing site-directed mutagenesis studies of Aave_2845?

Site-directed mutagenesis provides powerful insights into protein function:

• Target selection rationale:

  • Conserved residues identified through multiple sequence alignment

  • Predicted functional domains based on structural modeling

  • Residues in membrane-spanning regions versus loops

• Mutation strategy:

  • Conservative substitutions to test chemical properties

  • Alanine scanning to identify essential residues

  • Cysteine substitutions for accessibility studies

  • Domain swapping with homologs for functional region mapping

• Functional assessment:

  • Expression level and stability of mutant proteins

  • Subcellular localization analysis

  • Interaction partner binding studies

  • Phenotypic assays in the native bacterial context

What are the optimal storage conditions for maintaining recombinant Aave_2845 stability and activity?

Based on available information about the recombinant protein:

• Short-term storage:

  • Store working aliquots at 4°C for up to one week

  • Use buffer systems optimized for membrane proteins

• Long-term storage:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid freeze-thaw cycles

  • Tris/PBS-based buffer with 6% trehalose, pH 8.0 is recommended

  • Consider adding 5-50% glycerol (optimally 50%) for freeze protection

• Reconstitution protocol:

  • Briefly centrifuge before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles which damage membrane proteins

How can researchers assess and maintain the structural integrity of purified Aave_2845?

Quality control for membrane proteins presents unique challenges:

• Integrity assessment methods:

  • Circular dichroism spectroscopy to monitor secondary structure

  • Size exclusion chromatography to detect aggregation

  • Differential scanning fluorimetry to measure thermal stability

  • Activity assays specific to predicted function

• Stability enhancement strategies:

  • Optimize buffer composition (pH, salt concentration, additives)

  • Add stabilizing agents such as glycerol or specific lipids

  • Consider nanodiscs or liposome reconstitution for native-like environment

How does research on Aave_2845 complement other studies on A. citrulli virulence factors?

Understanding Aave_2845 in the broader context of A. citrulli research:

• Integration with known virulence mechanisms:

  • A. citrulli pathogenicity depends on swimming motility, twitching motility, biofilm formation, and the T3SS

  • Regulatory systems like BarA inhibit virulence and early proliferation

  • Membrane proteins may function within these networks

• Research gap analysis:

  • While T3SS effectors are relatively well-studied , membrane protein contributions to virulence are less characterized

  • Systematic studies of membrane proteome could reveal new virulence determinants

  • Host-specific adaptation mechanisms remain partially understood

What techniques from other bacterial pathogen studies could be applied to Aave_2845 research?

Translating methodologies from related fields:

• Advanced imaging techniques:

  • Super-resolution microscopy to visualize membrane localization

  • Correlative light and electron microscopy for structural context

  • Live-cell imaging to track dynamics during infection

• Systems biology approaches:

  • Proteomics to identify temporal changes in protein expression and modification

  • Interactomics to map protein-protein interaction networks

  • Transcriptomics to understand regulatory patterns

• Host-pathogen models:

  • Simplified plant infection models for high-throughput studies

  • In vitro reconstitution of host membrane interactions

  • Computational modeling of membrane protein dynamics