Recombinant Acidovorax ebreus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
mscL; Dtpsy_0751; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))
Target Names
mscL
Target Protein Sequence
MGIAKEFREFAVKGNVIDLAVGVIIGGAFGKIVDSVVSDLIMPVVGLVFGKLDFSNLFIV LGSVPEGTPYTLEAIRKAGVPVLAYGNFITVAVNFVILAFIIFVMVKQINRLKRETPVEP PAPPATPEDIQLLREIRDSLKR
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Large-Conductance Mechanosensitive Channels?

Mechanosensitive channels of large conductance (MscL) are membrane proteins that respond to mechanical forces in the cell membrane. Based on studies in other bacteria like Escherichia coli, MscL typically forms a homopentameric structure with each subunit containing two transmembrane regions . These channels function as emergency release valves that open in response to stretch forces in the lipid bilayer, helping bacterial cells respond to osmotic challenges.

The gating mechanism involves hydrophobic mismatch and changes in membrane curvature or transbilayer pressure profile, commonly referred to as the bilayer mechanism . While specific structural details for A. ebreus MscL are not extensively documented, comparative analysis with well-characterized homologs suggests it likely shares the core structural features that enable mechanosensation through membrane deformation.

How can recombinant A. ebreus MscL be expressed in laboratory settings?

Expression of recombinant mechanosensitive channels typically employs prokaryotic expression systems, particularly E. coli strains with disruptions in their native mscL genes to prevent interference . For optimal expression of A. ebreus MscL, researchers should consider:

  • Construction of an expression vector containing the A. ebreus mscL gene, potentially as a fusion protein with tags like glutathione S-transferase (GST) to facilitate purification

  • Transformation into an appropriate E. coli expression strain

  • Induction of protein expression using IPTG or other suitable inducers

  • Careful monitoring of expression conditions (temperature, induction time, media composition) to maximize yield while maintaining protein functionality

The expression as a fusion protein with GST, as demonstrated for E. coli MscL, allows for affinity purification using glutathione-coated beads, followed by thrombin cleavage to recover the pure MscL protein .

What are the recommended purification methods for recombinant A. ebreus MscL?

Purification of mechanosensitive channels requires strategies appropriate for membrane proteins. Based on established protocols for similar channels:

  • Cell lysis should be performed under conditions that preserve native protein structure

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (commonly n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity chromatography using tags engineered into the recombinant protein

  • Optional size exclusion chromatography for higher purity

For MscL proteins specifically, affinity purification using glutathione-coated beads for GST fusion proteins has been successfully employed, with subsequent cleavage using thrombin to release the MscL protein . Care must be taken during all purification steps to maintain the detergent concentration above the critical micelle concentration to prevent protein aggregation.

How can functional activity of recombinant A. ebreus MscL be verified?

Functional verification of MscL activity typically involves reconstitution into artificial liposomes followed by patch-clamp analysis. The methodology includes:

  • Preparation of liposomes with controlled lipid composition

  • Incorporation of purified MscL protein into liposomes

  • Patch-clamp recording to measure channel conductance in response to membrane tension

  • Verification of characteristic pressure sensitivity and conductance profiles

  • Optional confirmation with specific channel blockers like gadolinium

For E. coli MscL, reconstitution into artificial liposomes and subsequent patch-clamp analysis has successfully demonstrated that recombinant channels retain their mechanosensitive properties, exhibiting characteristic conductance and pressure sensitivity . Similar approaches would be applicable for A. ebreus MscL, with appropriate adjustments for potential differences in optimal lipid composition or pressure thresholds.

How does A. ebreus MscL compare to well-characterized homologs from other bacteria?

Comparing A. ebreus MscL with characterized homologs involves:

  • Sequence alignment analysis to identify conserved domains and unique regions

  • Structural modeling based on known crystal structures (e.g., M. tuberculosis MscL)

  • Comparative functional analysis of channel properties (conductance, pressure threshold)

  • Evolutionary relationship assessment through phylogenetic analysis

While the specific properties of A. ebreus MscL require experimental determination, the general principles of MscL function are conserved across bacterial species. The E. coli MscL protein is approximately 136 amino acids with a highly hydrophobic core , and similar features would be expected in the A. ebreus homolog. Careful comparison with both closely related Acidovorax species (like A. avenae) and more distant relatives can provide insights into the evolutionary conservation and specialization of these channels.

What are the specific gating mechanisms of A. ebreus MscL and how do they differ from other bacterial homologs?

Advanced investigation of A. ebreus MscL gating mechanisms would require:

  • Site-directed mutagenesis of key residues in the channel gate and tension-sensing regions

  • Patch-clamp analysis of mutant channels to determine effects on pressure threshold and gating kinetics

  • Molecular dynamics simulations to model conformational changes during channel opening

  • Structural studies using techniques like cryo-electron microscopy to visualize different conformational states

Research on E. coli MscL has shown that the channel gates via bilayer mechanism evoked by hydrophobic mismatch and changes in membrane curvature . Specific residues in the transmembrane domains play crucial roles in sensing membrane tension and translating it into conformational changes that open the channel pore. Comparative analysis between A. ebreus MscL and other bacterial homologs could reveal unique adaptations potentially related to the ecological niche of this bacterium.

How can advanced structural biology techniques be applied to study A. ebreus MscL?

Structural characterization of A. ebreus MscL can employ multiple complementary approaches:

  • X-ray crystallography of purified protein, potentially facilitated by fusion with crystallization chaperones

  • Cryo-electron microscopy of channels in different functional states

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic structural information

  • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

  • Molecular dynamics simulations to model conformational changes during gating

These techniques can reveal critical structural features such as the arrangement of transmembrane helices, the structure of the channel pore, and conformational changes associated with channel gating. Comparative structural analysis with other bacterial MscL proteins could highlight unique features of the A. ebreus channel that may relate to its specific physiological role.

What approaches can be used to study MscL-lipid interactions in A. ebreus?

The interaction between MscL and membrane lipids is critical for mechanosensation. Advanced studies could include:

  • Reconstitution into liposomes of defined lipid composition to determine optimal functional conditions

  • Fluorescence resonance energy transfer (FRET) analysis to measure conformational changes in response to different lipid environments

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to probe lipid-protein interactions

  • Mass spectrometry analysis of co-purifying lipids to identify specifically bound molecules

  • Molecular dynamics simulations of the channel in different lipid environments

These approaches can reveal how specific lipids affect channel function and potentially identify unique lipid requirements for A. ebreus MscL compared to other bacterial homologs. Given that MscL gating occurs via the bilayer mechanism involving hydrophobic mismatch and changes in membrane curvature , detailed understanding of lipid-protein interactions is essential for comprehending channel function.

How can genomic and transcriptomic approaches inform our understanding of MscL regulation in A. ebreus?

Multi-omics approaches provide insights into MscL regulation and expression patterns:

  • Genome analysis to identify regulatory elements in the mscL gene promoter region

  • RNA-Seq to determine expression patterns under different environmental conditions

  • ChIP-Seq to identify transcription factors regulating mscL expression

  • Comparative genomics across Acidovorax species to identify conserved regulatory mechanisms

  • Proteomics to measure MscL protein levels and potential post-translational modifications

In E. coli, MscL is constitutively expressed but upregulated during stationary phase and osmotic shock to prevent cell lysis . Analysis of A. ebreus under similar conditions could reveal conservation or divergence in regulatory mechanisms. The RT-qPCR methodologies described for gene expression analysis in A. avenae research could be adapted for studying mscL expression in A. ebreus.

What approaches can be used to investigate MscL's role in the osmotic stress response of A. ebreus?

Investigating the physiological role of MscL in osmotic stress response requires:

  • Construction of mscL knockout strains through gene deletion or disruption

  • Complementation studies with wild-type and mutant mscL genes

  • Growth and survival assays under various osmotic challenge conditions

  • Live cell imaging to visualize cellular responses to osmotic downshock

  • Measurements of cellular solute retention/release during osmotic transitions

These approaches can determine whether MscL functions as a "pressure release valve" in A. ebreus similar to its role in E. coli. The methods for bacterial strain construction and characterization described for Acidovorax studies could be adapted for investigating MscL function in osmotic stress response.

How can A. ebreus MscL be exploited for potential antimicrobial applications?

Exploiting MscL as an antimicrobial target involves several research directions:

  • Screening for compounds that specifically activate A. ebreus MscL, leading to inappropriate channel opening and potential cell lysis

  • Structure-based design of MscL-targeting molecules based on high-resolution structural data

  • Investigation of species-specific differences in MscL structure that could be exploited for selective targeting

  • Development of MscL-activating peptides or small molecules as potential antibacterial agents

  • Assessment of resistance development potential through directed evolution experiments

The pharmacological potential of MscL has been recognized for discovery of new antibiotics to combat multiple drug-resistant bacterial strains . If A. ebreus MscL has unique structural or functional features, these could potentially be exploited for selective targeting in contexts where this bacterium is pathogenic or problematic.

What controls should be included in functional studies of recombinant A. ebreus MscL?

Robust experimental design for MscL functional studies should include:

  • Positive controls using well-characterized MscL channels (e.g., E. coli MscL)

  • Negative controls using liposomes without reconstituted protein

  • Patch-clamp recordings in the presence of known MscL blockers like gadolinium

  • Mutant channels with altered mechanosensitivity for comparison

  • Multiple independent protein preparations to ensure reproducibility

As demonstrated in E. coli MscL studies, specific anti-MscL polyclonal antibodies can serve as functional inhibitors that abolish channel activity when preincubated with the MscL protein . Similar approaches could be employed for A. ebreus MscL to confirm the specificity of observed channel activities.

How can researchers address challenges in membrane protein crystallization for structural studies of A. ebreus MscL?

Membrane protein crystallization is notoriously challenging. Strategies to improve success include:

  • Screening multiple detergents and lipids to identify optimal solubilization conditions

  • Use of lipidic cubic phase crystallization methods specifically designed for membrane proteins

  • Generation of antibody fragments or crystallization chaperones to provide crystal contacts

  • Creation of fusion constructs with well-crystallizing proteins (e.g., T4 lysozyme)

  • Surface entropy reduction through targeted mutations of flexible regions

While specific crystallization conditions for A. ebreus MscL would need to be empirically determined, lessons from successful membrane protein crystallization projects can guide initial screening approaches. Alternative structural biology methods like cryo-electron microscopy might circumvent some crystallization challenges.

What approaches can be used to study the immune response to A. ebreus proteins in host-pathogen interactions?

If A. ebreus has pathogenic potential like some Acidovorax species, immunological studies might include:

  • Assessment of host pattern recognition receptor activation by A. ebreus components

  • Cytokine profiling in response to A. ebreus exposure

  • Investigation of specific immune signaling pathways activated during infection

  • Comparative immunological studies with related Acidovorax species

Studies with Acidovorax avenae have shown that flagellin can activate human immune responses through TLR5 and NLRC4, leading to secretion of inflammatory cytokines like TNF-α, IL-6, and IL-8 . Similar methodologies could be employed to study potential immunostimulatory effects of A. ebreus proteins, including MscL if exposed to the host immune system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.