Recombinant Acidovorax ebreus Probable intracellular septation protein A (Dtpsy_2029)

Shipped with Ice Packs
In Stock

Description

Overview of Dtpsy_2029

Dtpsy_2029 is a 186-amino acid protein encoded by the Dtpsy_2029 gene in Acidovorax ebreus TPSY. It belongs to the YciB family and is annotated as a probable intracellular septation protein involved in cell division . The recombinant form is produced in E. coli with an N-terminal His tag for purification .

Genomic Context

The Dtpsy_2029 gene is located on the single chromosome of A. ebreus TPSY (NCBI Accession: NC_011992) . Key genomic features:

FeatureDetail
Genomic Position2,171,647–2,172,207 bp on NC_011992
Protein IDUniProt: B9MAB3; GenBank: YP_002553485.1
Taxonomic ClassificationPhylum: Proteobacteria; Class: Betaproteobacteria; Family: Comamonadaceae

Pan-genome studies of Acidovorax species reveal that Dtpsy_2029 homologs are conserved among commensal and free-living strains, suggesting a fundamental role in bacterial physiology .

Protein Characteristics

The recombinant protein has the following biochemical properties:

PropertyDetail
Molecular Weight20,942 Da
Amino Acid SequenceMKLLIDFFPIILFFAAFKVWGIYVATAVAIAATVVQIGYIRLKHGKVEPLQWLSLGVIVLFGGATLLAHS...
Structural DomainsInner membrane-spanning regions; predicted multi-pass transmembrane topology
Purity>85–90% (SDS-PAGE)

The protein’s structure includes a dynein-related domain, which may facilitate interactions with other division machinery components .

Research Applications

Recombinant Dtpsy_2029 is utilized in:

  • Cell division studies: Investigating septation mechanisms in Betaproteobacteria .

  • Bioremediation research: A. ebreus TPSY oxidizes uranium, and Dtpsy_2029’s role in cell resilience may inform environmental cleanup strategies .

  • Plant-microbe interactions: Acidovorax strains colonize plant roots, and Dtpsy_2029 homologs are linked to genomic adaptations in plant-associated bacteria .

Production and Purification

The recombinant protein is produced under standardized conditions:

ParameterSpecification
Expression SystemE. coli with N-terminal His tag
StorageLyophilized or liquid form at -20°C/-80°C; 6–12 month shelf life
Reconstitution0.1–1.0 mg/mL in Tris/PBS buffer with 5–50% glycerol
YieldNot explicitly quantified, but typical for small transmembrane proteins

Functional Insights

  • Role in septation: Predicted to coordinate inner membrane dynamics during cell division via interactions with divisome proteins .

  • Localization: Inner membrane-associated, consistent with its function in compartmentalization .

  • Adaptive evolution: Genomic comparisons show Dtpsy_2029 is retained in free-living Acidovorax strains, unlike pathogens that lose septation genes during host adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your use.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
yciB; Dtpsy_2029; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))
Target Names
Dtpsy_2029
Target Protein Sequence
MKLLIDFFPIILFFAAFKVWGIYVATAVAIAATVVQIGYIRLKHGKVEPLQWLSLGVIVL FGGATLLAHSETFIKWKPTVLYWLMGGTLLVGQLMFRKNFIQSLMGAQIDLPAPVWRNLN WGWTGFFATMGVLNLWVAYHFDTDTWVNFKLFGGIGLMFAFVIAQALYLSRHVKDEGDAA PKDLQP
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Acidovorax ebreus Probable intracellular septation protein A (Dtpsy_2029)?

Dtpsy_2029 is classified as a Probable intracellular septation protein A from Acidovorax ebreus. The recombinant form is available as a full-length protein (1-186 amino acids) with a His-tag for purification purposes . Based on homology with similar proteins like Ajs_1675 from Acidovorax sp., it likely contains transmembrane domains characteristic of inner membrane-spanning proteins like YciB .

The protein likely shares structural features with other bacterial septation proteins involved in cell division processes. While the specific three-dimensional structure of Dtpsy_2029 has not been fully elucidated, researchers can leverage emerging AI-based protein structure prediction technologies like AlphaFold2 to predict its structure, which can provide insights into potential functional domains and interaction interfaces .

How does Dtpsy_2029 compare with similar proteins from other Acidovorax species?

Dtpsy_2029 belongs to a family of proteins found across various bacterial species. A similar protein, Ajs_1675 from Acidovorax sp., is also classified as a "Probable intracellular septation protein A" with synonyms including "yciB" and "Inner membrane-spanning protein YciB" . The amino acid sequence of Ajs_1675 (186 amino acids) provides a reference for comparison with Dtpsy_2029.

Across the Acidovorax genus, there is significant conservation of protein families with shared functions. For instance, the type III effector AopV from Acidovorax citrulli shows homology with proteins from Xanthomonas, Ralstonia, and Pseudomonas genomes, with conserved motifs that may be functionally important . Similar evolutionary relationships likely exist for septation proteins like Dtpsy_2029 across bacterial species.

ProteinSpeciesLengthKey Features
Dtpsy_2029Acidovorax ebreus186 aaProbable intracellular septation protein A
Ajs_1675Acidovorax sp.186 aaInner membrane-spanning protein YciB

What expression systems are optimal for producing recombinant Dtpsy_2029?

According to available data, recombinant Dtpsy_2029 is successfully expressed in E. coli expression systems with an N-terminal His-tag . This approach appears to be the standard method for producing this protein for research purposes. The expression in E. coli offers several advantages, including high yield, established protocols, and compatibility with affinity purification methods.

For optimal expression, researchers should consider the following methodological considerations:

  • Use of appropriate E. coli strains (such as BL21(DE3) for T7 promoter systems)

  • Optimization of induction conditions (temperature, IPTG concentration, induction time)

  • Codon optimization if necessary for heterologous expression

  • Addition of solubility-enhancing tags if the protein shows poor solubility

  • Consideration of specialized approaches for membrane protein expression if traditional methods yield poor results

How can researchers investigate the functional role of Dtpsy_2029 in bacterial cell division?

Investigating the functional role of Dtpsy_2029 in bacterial cell division requires a multi-faceted approach. As a probable intracellular septation protein, Dtpsy_2029 likely participates in septum formation during bacterial cell division. To elucidate its specific functions, researchers could employ the following methodologies:

  • Genetic manipulation approaches:

    • Gene knockout or knockdown studies to observe phenotypic effects on cell division

    • Complementation assays to confirm that observed phenotypes are directly related to Dtpsy_2029 function

    • Site-directed mutagenesis to identify critical functional residues

  • Localization studies:

    • Fluorescent protein tagging to visualize the spatiotemporal dynamics of Dtpsy_2029 during cell division

    • Immunolocalization with specific antibodies

    • Co-localization with known divisome components

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Bacterial two-hybrid assays to detect protein-protein interactions

    • In vitro binding assays with purified proteins

  • Phenotypic analysis:

    • Microscopic examination of cell morphology and division patterns in mutant strains

    • Growth rate analysis under various conditions

    • Cell envelope integrity assays

Transcriptomic approaches similar to those used for studying other Acidovorax species could also provide insights into how Dtpsy_2029 expression is regulated during different growth phases or environmental conditions .

What protein-protein interactions involve Dtpsy_2029, and how can they be experimentally verified?

While specific interaction partners of Dtpsy_2029 have not been definitively established in the available literature, its classification as an intracellular septation protein suggests it likely interacts with components of the bacterial cell division machinery. To identify and verify such interactions, researchers can employ multiple complementary approaches:

  • Screening for potential interactors:

    • Yeast two-hybrid (Y2H) screening against a genomic library from Acidovorax ebreus

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Bacterial two-hybrid (B2H) assays

  • Verification of identified interactions:

    • Co-immunoprecipitation (Co-IP) using antibodies against Dtpsy_2029 or the putative interactor

    • Pull-down assays with recombinant tagged proteins

    • Reciprocal verification where both proteins are used as "bait" in separate experiments

  • Visualization of interactions:

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence resonance energy transfer (FRET)

    • Proximity ligation assay (PLA)

  • Functional validation:

    • Epistasis analysis in genetic studies

    • In vitro reconstitution of activities using purified components

    • Mutational analysis of interaction interfaces

When conducting these experiments, it's crucial to include appropriate controls to distinguish specific from non-specific interactions, as exemplified in studies of other bacterial proteins where interactions were confirmed through multiple complementary approaches .

How might post-translational modifications regulate Dtpsy_2029 function?

Although specific post-translational modifications (PTMs) of Dtpsy_2029 have not been extensively documented in the available literature, as a bacterial membrane protein involved in cell division, it could be subject to various regulatory modifications. These might include:

  • Phosphorylation: Many bacterial cell division proteins are regulated by serine/threonine or tyrosine phosphorylation, which can affect protein-protein interactions, localization, or activity.

  • Proteolytic processing: Some septation proteins require proteolytic cleavage for activation or inactivation during specific stages of the cell cycle.

  • Disulfide bond formation: If Dtpsy_2029 contains cysteine residues, redox-dependent disulfide bond formation might regulate its activity in response to environmental conditions.

To investigate PTMs of Dtpsy_2029, researchers could employ:

  • Mass spectrometry-based approaches:

    • Shotgun proteomics to identify modified peptides

    • Targeted approaches focusing on specific modification types

    • Quantitative proteomics to compare modification levels under different conditions

  • Biochemical approaches:

    • Phospho-specific antibodies if phosphorylation is suspected

    • Mobility shift assays to detect modifications that alter protein migration

    • Chemical or enzymatic treatments to remove specific modifications

  • Mutational studies:

    • Site-directed mutagenesis of putative modification sites

    • Creation of phosphomimetic or non-phosphorylatable mutants

    • Analysis of phenotypic consequences of preventing modification

Understanding the PTMs of Dtpsy_2029 would provide valuable insights into how its function is dynamically regulated during bacterial cell division and in response to environmental cues.

What are the optimal conditions for expression and purification of recombinant Dtpsy_2029?

Based on available data for similar recombinant proteins, the following protocol represents optimal conditions for expression and purification of Dtpsy_2029:

Expression System:

  • Host: E. coli (typically BL21(DE3) or similar strains)

  • Vector: Expression vector with N-terminal His-tag

  • Induction: IPTG induction (concentration and temperature optimization recommended)

  • Growth medium: Standard LB or richer media such as TB for higher yields

Purification Strategy:

  • Cell lysis: Sonication or high-pressure homogenization in a suitable buffer system

  • Clarification: Centrifugation to remove cell debris

  • Affinity chromatography: Ni-NTA or similar affinity resin for His-tagged protein

  • Additional purification: Size exclusion chromatography if higher purity is required

  • Quality control: SDS-PAGE to assess purity (target >90%)

Buffer Considerations:

  • Lysis buffer: Typically Tris/PBS-based with protease inhibitors

  • Purification buffers: Tris/PBS-based with appropriate imidazole gradients for binding, washing, and elution

  • Final storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Storage Recommendations:

  • Long-term storage: -20°C/-80°C with 5-50% glycerol (50% recommended)

  • Aliquoting to avoid repeated freeze-thaw cycles

  • For short-term use, store working aliquots at 4°C for up to one week

  • Lyophilization may be considered for extended stability

How can researchers assess the functional activity of purified Dtpsy_2029?

Assessing the functional activity of purified Dtpsy_2029 requires approaches tailored to its role as an intracellular septation protein. While specific activity assays for Dtpsy_2029 have not been extensively documented, researchers can consider several methodological approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify proper secondary structure

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography to confirm proper oligomeric state

    • Limited proteolysis to assess proper folding

  • Membrane interaction assays:

    • Liposome binding assays

    • Reconstitution into proteoliposomes or nanodiscs

    • Membrane insertion efficiency tests

  • Protein-protein interaction assays:

    • Pull-down assays with known or suspected interaction partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Microscale thermophoresis for quantitative binding analysis

  • Functional complementation:

    • Introduction of purified protein into bacterial spheroplasts

    • Complementation of deletion mutants with purified protein

    • In vitro septal ring assembly assays

  • Enzymatic activity (if applicable):

    • ATPase or GTPase activity assays if Dtpsy_2029 possesses such domains

    • Other biochemical activities specific to septation proteins

Researchers should select assays based on the predicted function of Dtpsy_2029 and potentially develop novel assays specific to this protein's role in bacterial cell division.

What approaches are most effective for studying the localization of Dtpsy_2029 in bacterial cells?

Understanding the subcellular localization of Dtpsy_2029 is crucial for elucidating its function in bacterial cell division. Based on successful approaches used for similar proteins, researchers should consider these methodological strategies:

  • Fluorescent protein fusion approaches:

    • C- or N-terminal GFP/mCherry/YFP fusions for live-cell imaging

    • Verification that fusion proteins retain functionality

    • Time-lapse microscopy to track dynamics during cell division

    • Co-expression with other fluorescently labeled divisome components

  • Immunolocalization techniques:

    • Generation of specific antibodies against Dtpsy_2029

    • Immunofluorescence microscopy using fixed cells

    • Immunogold electron microscopy for higher resolution localization

    • Co-localization with known cell division markers

  • Advanced microscopy methods:

    • Super-resolution microscopy (STORM, PALM, or STED) for precise localization

    • Single-molecule tracking to monitor protein dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

  • Biochemical fractionation:

    • Membrane fractionation to confirm membrane association

    • Detergent solubility assays to characterize membrane domain association

    • Protease accessibility assays to determine topology

  • Cryo-electron tomography:

    • Visualization of Dtpsy_2029 in the context of the bacterial divisome

    • Immunogold labeling for specific identification

Similar approaches have been successfully employed to study localization of other bacterial proteins, such as the co-localization of AopV and ADT6 at the cell membrane in Acidovorax citrulli .

How should knockout studies of Dtpsy_2029 be designed to comprehensively assess its physiological role?

Designing effective knockout studies for Dtpsy_2029 requires careful planning to ensure reliable and comprehensive assessment of its physiological functions. Based on successful approaches with other bacterial proteins, researchers should consider the following experimental design:

  • Generation of knockout strains:

    • Allelic exchange methods using homologous recombination

    • CRISPR-Cas9 based genome editing for precise gene deletion

    • Confirmation of knockout by PCR, sequencing, and Western blotting

    • Creation of conditional mutants if Dtpsy_2029 is essential

  • Phenotypic characterization:

    • Growth curve analysis under various conditions (temperature, pH, osmolarity)

    • Cell morphology assessment using phase contrast and electron microscopy

    • Cell division dynamics using time-lapse microscopy

    • Cell envelope integrity tests (detergent sensitivity, antibiotic susceptibility)

  • Complementation studies:

    • Reintroduction of wild-type Dtpsy_2029 (chromosomal or plasmid-based)

    • Introduction of mutant versions to identify critical residues

    • Heterologous complementation with homologs from related species

    • Controlled expression using inducible promoters

  • Omics approaches:

    • Transcriptomic analysis (RNA-Seq) to identify affected pathways

    • Comparative proteomics to detect changes in protein expression

    • Metabolomic analysis to identify metabolic alterations

  • Stress response testing:

    • Exposure to various environmental stressors

    • Membrane stress agents

    • DNA-damaging treatments

    • Antibiotic challenge

This comprehensive approach has been successful in characterizing the function of various bacterial proteins, as exemplified by the knockout studies of T6SS genes in Acidovorax avenae that revealed their importance in bacterial pathogenicity .

How can researchers distinguish between direct and indirect effects when analyzing phenotypes of Dtpsy_2029 mutants?

Distinguishing between direct and indirect effects of Dtpsy_2029 disruption is crucial for accurately understanding its precise biological function. To address this challenge, researchers should implement a multi-faceted experimental approach:

  • Temporal analysis of effects:

    • Time-course experiments following gene inactivation

    • Use of inducible knockdown systems to observe immediate effects

    • Sequential sampling for transcriptomics and proteomics to identify early vs. late responses

  • Domain-specific mutagenesis:

    • Creation of point mutations in specific functional domains

    • Structure-guided mutagenesis targeting predicted functional sites

    • Conservative vs. non-conservative substitutions to assess functional importance

    • Correlation of specific mutations with discrete phenotypic outcomes

  • Suppressor screening:

    • Identification of secondary mutations that suppress Dtpsy_2029 deletion phenotypes

    • Characterization of synthetic lethal interactions

    • Isolation of bypass suppressors that reveal parallel pathways

  • Pathway analysis:

    • Epistasis studies with genes in related pathways

    • Double mutant analysis to establish genetic relationships

    • Overexpression studies to identify dosage-dependent interactions

  • Direct biochemical approaches:

    • In vitro reconstitution of activities with purified components

    • Structure determination of protein complexes

    • Identification of direct binding partners and substrates

These approaches collectively provide a framework for separating direct effects of Dtpsy_2029 function from downstream or compensatory changes that may occur in response to its disruption.

What statistical approaches are most appropriate for analyzing data from experiments involving Dtpsy_2029?

  • For growth and phenotypic assays:

    • Analysis of variance (ANOVA) for comparing multiple conditions

    • Student's t-test for pairwise comparisons (with appropriate corrections for multiple testing)

    • Mixed-effects models for time-course data with repeated measurements

    • Non-parametric alternatives (e.g., Mann-Whitney U test) when normality cannot be assumed

  • For microscopy and localization data:

    • Quantitative image analysis with standardized parameters

    • Colocalization coefficients (Pearson's, Manders') for protein colocalization studies

    • Distribution analysis for protein clustering patterns

    • Track analysis metrics for dynamic processes

  • For transcriptomic data:

    • Differential expression analysis using established pipelines (DESeq2, edgeR)

    • Multiple testing correction (FDR, Bonferroni)

    • Gene set enrichment analysis for pathway-level insights

    • Network analysis to identify co-regulated genes

  • For protein-protein interaction data:

    • Statistical filtering of mass spectrometry results to identify high-confidence interactors

    • Comparison to appropriate negative controls

    • Enrichment analysis against protein interaction databases

    • Calculation of interaction stoichiometry

  • For evolutionary analyses:

    • Phylogenetic methods to assess conservation and selection

    • Ka/Ks ratios to detect selective pressure

    • Comparative genomic approaches to identify synteny

In all cases, researchers should ensure appropriate biological and technical replicates, carefully consider sample sizes for adequate statistical power, and clearly report both the statistical methods and their underlying assumptions.

How might structural studies of Dtpsy_2029 inform the development of antimicrobial strategies?

Structural studies of Dtpsy_2029 could provide valuable insights for antimicrobial development, particularly if this protein proves essential for bacterial cell division in Acidovorax ebreus and related pathogens. Several approaches can connect structural information to antimicrobial strategies:

  • Structure-based drug design:

    • Identification of druggable pockets within the Dtpsy_2029 structure

    • In silico screening of compound libraries against these pockets

    • Structure-guided optimization of lead compounds

    • Design of peptide inhibitors that disrupt critical protein-protein interactions

  • Protein-protein interaction interfaces:

    • Mapping of interaction surfaces between Dtpsy_2029 and essential division proteins

    • Development of peptide mimetics that compete for binding sites

    • Identification of small molecules that disrupt critical interactions

  • Allosteric regulation:

    • Identification of allosteric sites that modulate Dtpsy_2029 function

    • Design of molecules that lock the protein in inactive conformations

    • Exploitation of species-specific structural features

  • Comparative structural biology:

    • Analysis of structural differences between bacterial and human homologs

    • Identification of unique structural features in bacterial septation proteins

    • Development of inhibitors with selectivity for bacterial targets

The continuous advancement of protein structure prediction technologies like AlphaFold2 mentioned in the literature could accelerate this process by providing structural models even before experimental structures are available .

How can systems biology approaches integrate Dtpsy_2029 function into broader bacterial physiological networks?

Systems biology approaches offer powerful frameworks for understanding how Dtpsy_2029 functions within the broader context of bacterial physiology. These integrative strategies can reveal emergent properties not apparent from studying the protein in isolation:

  • Multi-omics integration:

    • Combination of transcriptomics, proteomics, and metabolomics data

    • Correlation of Dtpsy_2029 expression patterns with global cellular responses

    • Identification of co-regulated genes and proteins

    • Construction of gene regulatory networks

  • Network analysis:

    • Placement of Dtpsy_2029 within protein-protein interaction networks

    • Identification of network motifs and regulatory hubs

    • Prediction of cellular responses to Dtpsy_2029 perturbation

    • Comparative network analysis across different bacterial species

  • Mathematical modeling:

    • Development of ordinary differential equation models of cell division

    • Agent-based modeling of divisome assembly

    • Flux balance analysis to connect cell division to metabolism

    • Sensitivity analysis to identify critical parameters

  • Evolutionary systems biology:

    • Comparison of septation systems across bacterial species

    • Analysis of co-evolution between interacting proteins

    • Identification of conserved network motifs

These approaches can build upon established methods such as the RNA-Seq analysis used to study Acidovorax avenae responses to environmental conditions and host interactions , extending beyond single-protein studies to understand system-level functions and regulation.

What are the most promising research directions for understanding Dtpsy_2029 involvement in bacterial resistance mechanisms?

While direct evidence linking Dtpsy_2029 to bacterial resistance mechanisms is limited in the current literature, its role as a probable intracellular septation protein suggests several promising research directions:

  • Stress response connections:

    • Investigation of Dtpsy_2029 expression and localization under antibiotic stress

    • Analysis of potential roles in cell envelope integrity maintenance

    • Examination of connections to stress-response pathways

    • Assessment of Dtpsy_2029 contribution to persister cell formation

  • Biofilm formation:

    • Evaluation of Dtpsy_2029 knockout effects on biofilm development

    • Analysis of cell morphology and division within biofilm structures

    • Investigation of potential interactions with extracellular matrix components

    • Comparison of resistance profiles between planktonic and biofilm states

  • Membrane physiology:

    • Characterization of membrane composition changes in Dtpsy_2029 mutants

    • Assessment of membrane permeability to antibiotics

    • Investigation of potential roles in membrane repair mechanisms

    • Analysis of interactions with membrane-modifying enzymes

  • Cell division coupling to resistance:

    • Examination of how altered cell division affects antibiotic susceptibility

    • Investigation of septation protein roles in antibiotic efflux

    • Analysis of potential interactions with resistance determinants

    • Development of combination therapies targeting both resistance and cell division

  • Comparative genomics:

    • Analysis of Dtpsy_2029 conservation in resistant clinical isolates

    • Identification of potential mutations associated with resistance phenotypes

    • Examination of genetic context and potential horizontal gene transfer

These research directions align with current understanding of bacterial resistance mechanisms and the known roles of septation proteins in maintaining cell envelope integrity under stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.