Recombinant Acidovorax ebreus Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock. If you require a specific format, please specify this when ordering.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Products are shipped with blue ice packs. Dry ice shipping is available upon request with additional charges; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; Dtpsy_0799; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))
Target Names
ubiB
Target Protein Sequence
MSRFARGITIVWVVLRYGLDELVLSTFRQPWLRAVTRVITFGRKLDAPRGQRLREALESL GPIFVKFGQVLSTRRDLMPPDIADELALLQDRVPPFDPDVAIATIERAFRRPIGEVFVSF DRQPVASASIAQVHFAVIRDRQGHAREVAVKVLRPGMLPVIDKDLALMRMMAGWVESLSA DGKRLKPREVVAEFDNYLHDELDLVREAANAAQLRRNMQGLDLVLIPEVFWDFCHAEVLV MERMKGVPINQVERLRSAGVDIPKLARDGVTIFFTQVFRDGFFHADMHPGNIQVSLAPET FGRYISLDFGIVGTLTEFDKEYLAQNFTAFFRRDYKRVAELHIESGWVPAHTRVNELEAA IRTVCEPYFDRPLKEISLGMVLLRLFQTSRRFQVEIQPQLVLLQKTLLNIEGLGRQLDPD LDLWSTAKPFLEKWMLDQLGPQRLWRELRAEAPHYAKILPDLPRLLHDFLRQRPHDNRGD LQELLATQKRTNRLLQSIIYGGLGFVLGLLVMQLFVRVRIF
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological function of UbiB in Acidovorax ebreus?

UbiB in Acidovorax ebreus is involved in ubiquinone (Coenzyme Q) biosynthesis, specifically required for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in the ubiquinone biosynthetic pathway . As a member of the ABC1 family and UbiB subfamily, it functions as a multi-pass membrane protein in the cell inner membrane . The biological role of UbiB is particularly significant in A. ebreus due to this organism's facultative anaerobic lifestyle, where ubiquinone serves as an essential electron carrier in respiratory chains, contributing to the bacterium's energy metabolism during both aerobic and anaerobic growth conditions .

What expression systems are most effective for producing recombinant UbiB protein from Acidovorax ebreus?

For recombinant UbiB expression, E. coli-based systems (BL21(DE3), Rosetta, or C41/C43 strains) are typically employed for initial screening, but membrane proteins like UbiB often present expression challenges. Methodologically:

  • Optimized approach: Use lower induction temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.3 mM) to minimize inclusion body formation.

  • Alternative systems: Consider Pichia pastoris for eukaryotic expression, which can properly fold complex membrane proteins.

  • Cell-free systems: For difficult-to-express membrane proteins, cell-free expression systems supplemented with lipid nanodiscs or detergent micelles can improve folding and solubility.

A protocol combining the pET vector system with C41(DE3) cells, expressing at 18°C following induction with 0.2 mM IPTG, has shown promising results for UbiB family proteins, achieving approximately 1-2 mg/L culture yield after initial purification .

How can researchers effectively solubilize and purify recombinant UbiB for structural studies?

UbiB presents challenges as a multi-pass membrane protein. The recommended methodological approach involves:

  • Membrane fraction isolation: After cell lysis, separate membrane fractions through ultracentrifugation (100,000×g for 1 hour).

  • Detergent screening: Test a panel of detergents including DDM (n-Dodecyl β-D-maltoside), LMNG (Lauryl Maltose Neopentyl Glycol), and digitonin at concentrations just above their CMC values.

  • Purification strategy:

    • Solubilize membranes in buffer containing selected detergent (2 hours at 4°C)

    • Clarify by centrifugation (100,000×g for 30 minutes)

    • Apply to appropriate affinity column based on fusion tag

    • Include size exclusion chromatography as a final purification step

Alternative approaches include styrene-maleic acid (SMA) lipid particles (SMALPs) technology, which can extract membrane proteins with their native lipid environment intact, potentially maintaining physiological activity .

What analytical techniques are most informative for studying UbiB structure-function relationships?

For comprehensive structural and functional analysis of UbiB proteins, employ multiple complementary techniques:

TechniqueApplicationResolution/Information
X-ray crystallographyHigh-resolution structure determinationPotentially atomic resolution (1-3Å)
Cryo-EMStructure determination without crystallizationNear-atomic resolution (2-4Å)
Hydrogen-deuterium exchange MSConformational dynamics, ligand interactionsPeptide-level information
Site-directed mutagenesisFunctional residue identificationIdentifying critical residues (e.g., PKL family and UbiB-specific motifs)
ATPase activity assaysEnzymatic function characterizationQuantitative kinetic parameters
Isothermal titration calorimetryBinding affinity measurementsThermodynamic binding parameters
Complementation studiesIn vivo functional validationPhenotypic rescue analysis

Researchers studying UbiB homologs have demonstrated that mutations in protein kinase-like (PKL) family residues impair function, suggesting that UbiB possesses atypical kinase/ATPase activity critical for ubiquinone biosynthesis regulation .

How can researchers effectively design experiments to assess UbiB's role in ubiquinone biosynthesis in Acidovorax ebreus?

To investigate UbiB's specific role in ubiquinone biosynthesis:

  • Gene knockout and complementation analysis:

    • Generate precise ubiB deletion mutants in A. ebreus using CRISPR-Cas9 or homologous recombination

    • Complement with wild-type and mutant variants (focusing on PKL and UbiB-specific motifs)

    • Assess growth under aerobic vs. anaerobic nitrate-reducing conditions

  • Ubiquinone quantification:

    • Extract lipids from wild-type, ΔubiB mutants, and complemented strains

    • Analyze ubiquinone content using HPLC-UV or LC-MS/MS methods

    • Monitor both ubiquinone levels and accumulation of biosynthetic intermediates

  • Metabolic flux analysis:

    • Use stable isotope-labeled precursors (13C-labeled 4-hydroxybenzoate)

    • Trace incorporation into biosynthetic intermediates

    • Identify pathway blockages in mutant strains

When designing these experiments, account for A. ebreus's facultative lifestyle by comparing phenotypes under both aerobic and anaerobic nitrate-reducing conditions, as the requirement for UbiB function may differ between these physiological states .

What are the methodological considerations for investigating UbiB's potential role in CoQ distribution within bacterial membranes?

Building on insights from eukaryotic UbiB homologs (Cqd1, Cqd2) , researchers can investigate potential roles in CoQ distribution:

  • Membrane fractionation approach:

    • Separate inner and outer membranes using sucrose density gradient ultracentrifugation

    • Quantify ubiquinone in each fraction by HPLC or LC-MS

    • Compare wild-type vs. UbiB mutant distribution profiles

  • Fluorescent CoQ analog tracing:

    • Synthesize fluorescent ubiquinone analogs

    • Monitor localization using high-resolution microscopy

    • Quantify membrane distribution changes in UbiB mutants

  • Proteomics of membrane contact sites:

    • Identify potential protein complexes involving UbiB using proximity labeling approaches

    • Consider crosslinking mass spectrometry to capture transient interactions

    • Map the UbiB interactome under different growth conditions

Research on UbiB homologs suggests these proteins may influence CoQ distribution through mechanisms involving atypical kinase/ATPase activity, making it essential to determine whether UbiB functions enzymatically or as a structural component of a larger complex .

How might UbiB function relate to Acidovorax ebreus' ability to oxidize iron and uranium anaerobically?

A. ebreus strain TPSY has the notable ability to anaerobically oxidize iron and uranium when coupled with nitrate reduction . UbiB's role in ubiquinone biosynthesis may critically impact these processes:

  • Electron transport considerations:

    • Ubiquinone likely serves as an electron carrier in anaerobic respiratory chains

    • UbiB disruption may impair electron flow from Fe(II)/U(IV) to nitrate

  • Experimental approach:

    • Construct UbiB mutants with defined mutations in catalytic residues

    • Measure Fe(II) and U(IV) oxidation rates coupled to nitrate reduction

    • Determine whether exogenous ubiquinone can rescue deficient phenotypes

  • Redox stress hypothesis:

    • Iron and uranium oxidation may generate reactive oxygen species

    • Ubiquinone's antioxidant properties might protect cellular components

    • Test whether UbiB mutants show increased sensitivity to redox stress during metal oxidation

Studies of UbiB function could provide insight into the molecular mechanisms underlying A. ebreus's bioremediation potential for uranium-contaminated environments .

What methodological approaches can connect UbiB function to Acidovorax ebreus' survival in contaminated groundwater environments?

To establish the ecological relevance of UbiB:

  • Environmental simulation experiments:

    • Design bioreactors mimicking contaminated groundwater conditions

    • Compare survival and activity of wild-type vs. UbiB-deficient strains

    • Monitor gene expression under environmental stress conditions

  • Competitive fitness assays:

    • Co-culture wild-type and UbiB mutants in simulated groundwater

    • Track relative abundance over time using strain-specific markers

    • Determine competitive index under various stressors (heavy metals, nitrate limitation)

  • In situ gene expression analysis:

    • Develop methods to recover and analyze A. ebreus from environmental samples

    • Quantify ubiB expression relative to housekeeping genes

    • Correlate expression with environmental parameters

A. ebreus was originally isolated from groundwater at the U.S. Department of Energy site at Oak Ridge, TN , making these environmentally relevant assays particularly valuable for understanding UbiB's contribution to survival in its native habitat.

How does the UbiB protein from Acidovorax ebreus compare structurally and functionally to UbiB homologs from other bacteria?

Comparative analysis reveals insights about functional conservation and specialization:

OrganismUbiB HomologDistinctive FeaturesFunctional Context
Acidovorax ebreusUbiBMulti-pass membrane protein, ABC1 familyAnaerobic metal oxidation, nitrate respiration
Escherichia coliUbiBRequired for aerobic hydroxylation of ubiquinone precursorsAerobic respiration
Saccharomyces cerevisiaeCqd1, Cqd2Reciprocally regulate CoQ distributionMitochondrial-to-cytosolic CoQ transport
Salmonella entericaUbiBRequired for virulence in macrophagesHost-pathogen interactions

Key methodological approaches for comparative studies:

  • Phylogenetic analysis of UbiB proteins across diverse bacterial species, focusing on correlation between protein sequence divergence and ecological niches

  • Heterologous complementation experiments to determine functional conservation

  • Protein domain swapping between homologs to identify specialized regions

Research indicates that while core UbiB functions in ubiquinone biosynthesis are conserved, specific adaptations may have evolved for different ecological contexts, such as S. enterica's requirement for UbiB in macrophage proliferation and virulence .

What is the biochemical mechanism by which UbiB functions in the ubiquinone biosynthetic pathway?

Despite UbiB's established role in ubiquinone biosynthesis, its precise biochemical mechanism remains incompletely characterized. Current evidence and hypotheses suggest:

  • Atypical kinase activity hypothesis:

    • UbiB contains protein kinase-like (PKL) fold motifs

    • Site-directed mutagenesis of conserved kinase-like residues abolishes function

    • May phosphorylate biosynthetic intermediates or regulatory proteins

  • ATPase coupling hypothesis:

    • UbiB may function as an ATPase rather than a true kinase

    • ATP hydrolysis could power conformational changes needed for hydroxylation

    • Energy input might be required to position substrates for non-enzymatic reactions

  • Experimental approaches to resolve mechanism:

    • In vitro reconstitution of UbiB activity with purified components

    • Identify potential phosphorylated intermediates using phosphoproteomics

    • Structural studies of UbiB-substrate complexes at different catalytic stages

Studies of UbiB homologs (Cqd1, Cqd2) indicate that these proteins contain an atypical protein kinase-like (PKL) fold that enables ATPase activity but appears to occlude larger proteinaceous substrates from entering the active site . This suggests UbiB may act on small molecules rather than proteins.

How do genetic and environmental factors influence UbiB expression and activity in Acidovorax ebreus?

Understanding UbiB regulation requires investigation of multiple factors:

  • Transcriptional regulation:

    • Identify promoter elements controlling ubiB expression

    • Determine transcription factors responding to oxygen, nitrate, and metal availability

    • Quantify transcript levels under various environmental conditions using RT-qPCR

  • Post-translational regulation:

    • Investigate potential phosphorylation sites using phosphoproteomics

    • Examine protein stability under different growth conditions

    • Identify interacting proteins that might modulate activity

  • Environmental response:

    • Design factorial experiments testing combinations of:

      • Oxygen levels (aerobic, microaerobic, anaerobic)

      • Electron acceptors (oxygen, nitrate, nitrite)

      • Electron donors (organic carbon, Fe(II), U(IV))

      • Heavy metal stressors

    • Measure both UbiB levels and ubiquinone production under each condition

Given A. ebreus' facultative lifestyle and diverse metabolic capabilities (iron oxidizer, uranium oxidizer) , UbiB regulation likely involves complex integration of redox state, energy status, and environmental signals to maintain appropriate ubiquinone levels across different growth conditions.

What are the current limitations and knowledge gaps in understanding UbiB function in Acidovorax ebreus?

Several significant knowledge gaps hamper complete understanding of UbiB:

  • Structural information: No high-resolution structure of UbiB from A. ebreus or close homologs is currently available, limiting structure-function insights.

  • Direct biochemical activity: The precise enzymatic activity (if any) remains unproven, with uncertainty about whether UbiB acts as a true kinase, ATPase, or has another biochemical function.

  • Substrate specificity: The exact substrates and products of UbiB-catalyzed reactions in vivo remain incompletely characterized.

  • Regulatory networks: How UbiB expression and activity respond to environmental conditions relevant to A. ebreus' ecology is poorly understood.

  • Protein-protein interactions: Potential interaction partners of UbiB that might influence its function or localization remain unidentified.

Future studies should prioritize addressing these fundamental knowledge gaps using interdisciplinary approaches combining structural biology, biochemistry, genetics, and environmental microbiology.

What novel methodological approaches might advance understanding of UbiB and ubiquinone biosynthesis in Acidovorax ebreus?

Emerging technologies offer promising avenues for UbiB research:

  • CRISPR interference (CRISPRi) and CRISPRa systems: Develop tools for conditional knockdown or overexpression of UbiB to study partial loss-of-function phenotypes.

  • Single-molecule tracking: Apply fluorescent protein fusions and super-resolution microscopy to monitor UbiB dynamics and localization in living cells under different metabolic conditions.

  • Synthetic biology approaches: Engineer simplified ubiquinone biosynthetic pathways in heterologous hosts to isolate and characterize UbiB function without confounding factors.

  • Membrane nanodisc technology: Reconstitute purified UbiB in defined lipid environments to study how membrane composition affects activity.

  • Metabolic flux analysis: Apply stable isotope labeling and metabolomics to trace ubiquinone biosynthesis in real-time under different conditions.

  • Environmental transcriptomics: Sample A. ebreus from contaminated sites and analyze gene expression patterns to understand UbiB regulation in natural settings.

These approaches could overcome current technical barriers to studying membrane-associated proteins like UbiB and provide new insights into their roles in bacterial physiology and ecology.

How might understanding UbiB function contribute to bioremediation applications using Acidovorax ebreus?

A. ebreus strain TPSY's ability to anaerobically oxidize iron and uranium when coupled with nitrate reduction makes it potentially valuable for bioremediation of uranium-contaminated environments . UbiB research could enhance these applications through:

  • Engineered strains with optimized UbiB expression:

    • Develop strains with enhanced metal oxidation capacity

    • Adjust UbiB and ubiquinone levels to optimize electron transfer efficiency

    • Create variants with improved survival in contaminated environments

  • Biomarkers for monitoring bioremediation:

    • Use UbiB expression levels as indicators of active metabolism

    • Develop assays to monitor A. ebreus activity in environmental samples

    • Correlate UbiB function with uranium transformation rates

  • Methodological approach for field application:

    • Compare wild-type and UbiB-optimized strains in pilot bioremediation studies

    • Monitor strain persistence, activity, and contaminant transformation

    • Assess genetic stability of engineered strains in environmental conditions

Understanding how UbiB contributes to A. ebreus' unique metabolic capabilities could lead to more effective and predictable bioremediation strategies for uranium-contaminated groundwater.

What experimental approaches can elucidate potential relationships between UbiB function and stress resistance in Acidovorax ebreus?

UbiB's role in ubiquinone biosynthesis may significantly impact stress resistance, particularly given ubiquinone's antioxidant properties:

  • Oxidative stress challenge assays:

    • Expose wild-type and UbiB-deficient strains to oxidative stressors (H₂O₂, paraquat)

    • Measure survival rates, growth inhibition, and recovery

    • Quantify oxidative damage markers (lipid peroxidation, protein carbonylation)

  • Metal toxicity experiments:

    • Test resistance to various metals beyond iron and uranium

    • Determine minimum inhibitory concentrations for each strain

    • Investigate whether ubiquinone supplementation rescues sensitivity phenotypes

  • Combined stress experiments:

    • Design factorial experiments with multiple stressors (oxidative, metal, pH, temperature)

    • Identify synergistic effects that might be particularly relevant in contaminated environments

    • Develop predictive models of stress response based on UbiB activity levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.