Recombinant Acidovorax ebreus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Classification and Functional Role

EC Number: 3.6.1.27
Systematic Name: Undecaprenyl-diphosphate phosphohydrolase .
Catalytic Reaction:

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

This reaction is divalent cation-dependent, with Ca²⁺ enhancing activity .

Biological Significance:

  • Essential for recycling Und-PP generated during cell wall synthesis .

  • Implicated in bacitracin resistance by maintaining Und-P pools .

Biochemical Properties

PropertyDetails
Expression SystemRecombinant production in yeast .
Purity>85% (SDS-PAGE) .
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C .
ActivityEnhanced by Ca²⁺; inhibited by bacitracin .

Stability Notes:

  • Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C retain function for ≤1 week .

Research Findings and Applications

Functional Insights:

  • In E. coli, UppP accounts for 75% of cellular Und-PP phosphatase activity, primarily in de novo Und-P synthesis .

  • Acidovorax ebreus UppP homologs share conserved domains with E. coli, suggesting analogous roles in cell wall metabolism .

Antibiotic Resistance:

  • Deletion of uppP in E. coli increases fosmidomycin sensitivity, linking it to Und-P recycling under stress .

Biotechnological Applications:

  • Target for antibacterial drug discovery due to its essential role in cell wall synthesis .

  • Used in enzymatic assays to screen inhibitors like MAC-0547630, which selectively target Und-PP metabolism .

Comparative Analysis with Homologs

FeatureAcidovorax ebreus UppPEscherichia coli UppP
Gene LocusDtpsy_1072 uppP (bacA)
Active Site Motifs(E/Q)XXXE, PGXSRSXXT (predicted) Confirmed periplasmic orientation
Role in Bacitracin ResistanceImplied Directly demonstrated

Future Directions

  • Structural studies (e.g., cryo-EM or crystallization) to resolve active-site architecture.

  • High-throughput screening for species-specific inhibitors leveraging recombinant UppP .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be defined during production. If you have a preferred tag type, please inform us and we will prioritize developing it accordingly.
Synonyms
uppP; Dtpsy_1072; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))
Target Names
uppP
Target Protein Sequence
MDTLLLLKAAIMGVVEGLTEFLPISSTGHLILAGSLLGFDDAKAKVFDIAIQTGAIFAVI LVYWQRIRATLVALPTERQARRFALNVLIGFLPAVLLGLLLGKAIKAHLFTPVVVASTFI LGGFVILWAERRQQAAVRIHAVDDMTPLDALKVGLVQCLAMVPGTSRSGATIIGGMLLGL SRKAATDYSFFLAIPTLIGAGVYSLYKERALLSAADIPLFAVGLVFSFISAWLCVRWLLR YISSHSFVPFAWYRIAFGLVVLVTAWSGLVTWAE
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Provides resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Undecaprenyl-diphosphatase (uppP)?

Undecaprenyl-diphosphatase (EC 3.6.1.27) is a hydrolase enzyme that catalyzes the conversion of undecaprenyl diphosphate to undecaprenyl phosphate through the following reaction:

undecaprenyl diphosphate + H₂O → undecaprenyl phosphate + phosphate

This enzymatic activity is critical for bacterial cell wall biosynthesis, particularly peptidoglycan synthesis. The reaction represents a key recycling step in the lipid II cycle, where the carrier lipid undecaprenol is regenerated for further rounds of cell wall precursor transport across the bacterial membrane. The enzyme's activity is notably enhanced by divalent cations, particularly Ca²⁺ .

How does uppP contribute to bacterial antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase plays a significant role in bacterial resistance to certain antibiotics, particularly bacitracin. The mechanism involves:

  • Competition for substrate: UppP dephosphorylates undecaprenyl diphosphate (UPP), which is also the target of bacitracin. By rapidly converting UPP to UP, the enzyme reduces available target molecules for bacitracin binding.

  • Maintenance of cell wall synthesis: By ensuring continued recycling of the lipid carrier, UppP allows cell wall synthesis to proceed even in the presence of moderate levels of bacitracin.

In Bacillus subtilis, deletion of bcrC (one of the UPP phosphatases) reduces bacitracin resistance from >256 μg/ml to approximately 120 μg/ml, while complementation with ectopically integrated UPP phosphatase genes restores resistance. This demonstrates the direct relationship between UPP phosphatase activity and bacitracin resistance .

What are the optimal storage conditions for recombinant Acidovorax ebreus uppP?

For optimal stability and activity of recombinant Acidovorax ebreus uppP, follow these storage guidelines:

Storage PurposeTemperatureBuffer ConditionsAdditional Recommendations
Long-term storage-80°CTris-based buffer with 50% glycerolStore in small aliquots to avoid repeated freeze-thaw cycles
Medium-term storage-20°CTris-based buffer with 50% glycerolSuitable for storage up to several months
Working stock4°CTris-based buffer with 50% glycerolMaintain for no more than one week

Critically, repeated freezing and thawing should be avoided as this can significantly reduce enzymatic activity. The inclusion of 50% glycerol in the storage buffer helps prevent ice crystal formation during freezing, which could otherwise damage protein structure. For experiments requiring extended use, prepare multiple working aliquots rather than repeatedly accessing the main stock .

How can researchers effectively design expression systems for recombinant uppP?

When designing expression systems for recombinant uppP, consider the following methodological approach:

  • Vector selection: Choose expression vectors with inducible promoters (such as T7 or tac) to control expression levels, as overexpression of membrane proteins can be toxic to host cells.

  • Host strain considerations: Use host strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3) for E. coli-based systems.

  • Fusion tags: Include purification tags that facilitate membrane protein solubilization and purification. Common options include:

    • N-terminal His₆ tag with a TEV protease cleavage site

    • C-terminal Strep-tag II

    • MBP fusion for improved solubility

  • Codon optimization: Adjust the coding sequence for optimal codon usage in the expression host, particularly important when expressing Acidovorax ebreus proteins in E. coli or other heterologous hosts.

  • Expression conditions: Optimize temperature (typically 16-25°C for membrane proteins), inducer concentration, and expression duration to maximize yield of correctly folded protein.

This methodological framework accounts for the challenges associated with expressing membrane proteins like uppP, which require special considerations beyond those for soluble proteins.

What techniques are most effective for studying the interaction between uppP and bacitracin?

To effectively study the interactions between uppP and bacitracin, researchers should employ complementary approaches:

  • Enzymatic activity assays:

    • Measure uppP phosphatase activity using colorimetric assays for phosphate release

    • Determine IC₅₀ values by measuring enzyme activity in the presence of varying bacitracin concentrations

    • Include appropriate controls with known UPP phosphatases like BcrC from B. subtilis

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to determine binding constants

    • Surface plasmon resonance (SPR) to measure real-time binding kinetics

    • Fluorescence-based assays using labeled bacitracin

  • Structural approaches:

    • X-ray crystallography of uppP with and without bound bacitracin (similar to available E. coli structures, PDB IDs: 5OON, 6CB2)

    • Molecular docking simulations to predict binding sites

    • Site-directed mutagenesis of predicted bacitracin interaction sites

  • In vivo resistance studies:

    • Express Acidovorax ebreus uppP in bacitracin-sensitive strains and measure changes in minimum inhibitory concentration (MIC)

    • Compare with known resistance determinants like BcrC from B. subtilis, which reduces bacitracin sensitivity from >256 μg/ml to ~120 μg/ml when deleted

This multi-faceted approach enables comprehensive characterization of the specific mechanisms by which uppP confers bacitracin resistance.

How does the function of Acidovorax ebreus uppP compare with homologous enzymes from other bacterial species?

Comparative analysis of uppP from different bacterial species reveals important functional and structural insights:

SpeciesEnzyme NameKey Functional DifferencesAntibiotic Resistance ContributionNotable Structural Features
Acidovorax ebreusuppPFull characterization pendingPresumed bacitracin resistance274 amino acids, membrane protein with multiple transmembrane domains
Bacillus subtilisUppPEssential gene (synthetic lethality with bcrC); important for sporulationMild contribution to bacitracin resistanceFunctions alongside BcrC
Bacillus subtilisBcrCSecondary UPP phosphatase; responds to cell envelope stressPrimary determinant of bacitracin resistanceStress-responsive expression
Escherichia coliBacAWell-characterized structureSignificant bacitracin resistance factorCrystal structures available (PDB: 5OON, 6CB2)

The synthetic lethality observed between uppP and bcrC in B. subtilis demonstrates the essential nature of UPP phosphatase activity for bacterial viability. Neither gene alone is essential, but at least one must be present for cell survival, indicating functional redundancy with distinct physiological roles. While UppP appears more important for sporulation processes, BcrC plays a more significant role in bacitracin resistance and cell envelope stress response .

What are the key considerations when designing site-directed mutagenesis experiments for uppP functional studies?

When designing site-directed mutagenesis experiments to investigate uppP function, researchers should follow this methodological framework:

  • Target residue selection:

    • Focus on predicted catalytic residues based on sequence alignment with characterized homologs

    • Target conserved motifs across the UPP phosphatase family

    • Consider residues in transmembrane regions that may interact with the lipid substrate

    • Include residues implicated in divalent cation binding, particularly those coordinating Ca²⁺

  • Mutation strategy:

    • Conservative substitutions (e.g., Asp to Glu) to test specific chemical properties

    • Alanine scanning of putative active site regions

    • Introduction of bulky residues to test spatial constraints

    • Charge reversal mutations to examine electrostatic interactions

  • Functional assays:

    • Enzymatic activity measurements using purified mutant proteins

    • In vivo complementation of UPP phosphatase-deficient strains

    • Bacitracin resistance assays to correlate structure with antibiotic resistance

    • Measure effects on bacterial cell morphology and wall homeostasis

  • Controls and validation:

    • Include wild-type enzyme controls under identical conditions

    • Verify protein expression and membrane localization of mutants

    • Confirm proper folding through limited proteolysis or circular dichroism

    • Validate results against known structure-function relationships from related enzymes

This approach enables systematic mapping of functional domains and catalytic mechanisms of Acidovorax ebreus uppP, providing insights into both fundamental enzymology and antibiotic resistance mechanisms.

What are common challenges in purifying active recombinant uppP and how can they be addressed?

Purification of active membrane proteins like uppP presents several technical challenges that can be addressed through specific methodological approaches:

ChallengeUnderlying CauseSolution Strategy
Low expression yieldToxicity due to membrane protein overexpressionUse tightly controlled inducible systems; lower induction temperature (16-18°C); use specialized host strains (C41/C43)
Protein aggregationImproper membrane extraction or detergent selectionScreen multiple detergents (DDM, LMNG, CHAPS); include glycerol (10-20%) in buffers; add lipids during purification
Loss of activity during purificationDestabilization of native conformationInclude appropriate lipids in purification buffers; maintain divalent cations (particularly Ca²⁺); use gentle elution conditions
Difficulty in assessing purityCo-purification of host membrane proteinsUse orthogonal purification steps; include ion exchange chromatography after initial affinity purification
Variable enzymatic activityIncomplete removal of detergents or presence of inhibitorsDialyze extensively; use bio-beads for detergent removal; verify activity with known substrates

When working specifically with Acidovorax ebreus uppP, researchers should be aware that like other undecaprenyl-diphosphatases, the activity is enhanced by divalent cations, particularly Ca²⁺. Therefore, purification buffers should be supplemented with appropriate concentrations of CaCl₂ to maintain enzymatic function .

How can researchers effectively design assays to measure uppP enzymatic activity?

To effectively measure uppP enzymatic activity, researchers can implement the following methodological approaches:

  • Phosphate release assays:

    • Malachite green-based colorimetric detection of released inorganic phosphate

    • EnzChek Phosphate Assay for continuous monitoring

    • ³²P-labeled substrate approach for highest sensitivity

  • Substrate preparation considerations:

    • Synthesize or purify undecaprenyl diphosphate substrate

    • Prepare substrate in appropriate detergent micelles

    • Consider using fluorescently labeled substrates for HPLC-based assays

  • Reaction conditions optimization:

    • Buffer composition: Typically Tris or HEPES (pH 7.4-8.0)

    • Divalent cation concentration: 1-5 mM Ca²⁺ or Mg²⁺

    • Detergent type and concentration: Must maintain enzyme stability without interfering with activity

    • Temperature and time course: Generally 30-37°C with time points from 5-60 minutes

  • Controls and validation:

    • No-enzyme controls to account for spontaneous hydrolysis

    • Heat-inactivated enzyme controls

    • Known UPP phosphatase (e.g., purified BacA from E. coli) as positive control

    • Phosphatase inhibitor controls to confirm specificity

  • Data analysis:

    • Initial velocity measurements from linear portion of progress curves

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Analysis of cation dependence and inhibition patterns

This comprehensive approach enables reliable quantification of uppP activity, essential for structure-function studies, inhibitor screening, and comparative analysis with homologous enzymes.

What are promising research avenues for exploiting uppP in antibiotic development?

Given the essential role of UPP phosphatases in bacterial cell wall biosynthesis, several strategic research directions hold promise for antibiotic development:

  • Structure-based inhibitor design:

    • Utilize crystal structures of UPP phosphatases (like those available for E. coli, PDB IDs: 5OON, 6CB2) to design specific inhibitors

    • Target the catalytic site with transition-state analogs

    • Develop allosteric inhibitors that prevent conformational changes required for activity

  • Combination therapy approaches:

    • Design inhibitors that synergize with bacitracin by blocking the resistance mechanism

    • Explore dual-targeting approaches that simultaneously inhibit UPP phosphatases and other cell wall synthesis enzymes

    • Investigate the potential for reversing existing antibiotic resistance

  • Species-specific targeting:

    • Identify structural and functional differences between UPP phosphatases from different bacterial species

    • Design inhibitors that selectively target pathogenic species while sparing beneficial microbiota

    • Focus on unique features of Acidovorax ebreus uppP compared to homologs from other species

  • Methodological innovations:

    • Develop high-throughput screening systems for UPP phosphatase inhibitors

    • Implement whole-cell assays that report on cell wall synthesis inhibition

    • Utilize synthetic genetic approaches to identify synthetic lethal interactions that could inform combination therapies

The synthetic lethality observed between uppP and bcrC in B. subtilis highlights the potential of targeting multiple UPP phosphatases simultaneously to achieve more complete inhibition of bacterial growth .

How might computational approaches enhance our understanding of uppP structure-function relationships?

Computational approaches offer powerful tools for investigating uppP structure-function relationships:

  • Homology modeling and structural prediction:

    • Generate structural models of Acidovorax ebreus uppP based on known structures of homologous enzymes (such as E. coli BacA)

    • Predict transmembrane topology and membrane insertion orientation

    • Identify potential substrate binding pockets and catalytic residues

  • Molecular dynamics simulations:

    • Simulate enzyme behavior in membrane environments

    • Investigate conformational changes during catalysis

    • Examine effects of mutations on protein stability and function

    • Model interactions with potential inhibitors

  • Systems biology approaches:

    • Analyze gene co-expression networks to identify functional relationships

    • Model effects of uppP inhibition on cell wall biosynthetic pathways

    • Predict potential resistance mechanisms that might emerge against uppP inhibitors

    • Integrate transcriptomic and proteomic data to understand regulatory networks

  • Machine learning applications:

    • Develop predictive models for inhibitor binding based on structure-activity relationships

    • Classify UPP phosphatases across species to identify subfamily-specific features

    • Design optimized enzyme variants with enhanced catalytic properties

These computational approaches complement experimental methods and can significantly accelerate research by generating testable hypotheses about enzyme function, guiding experimental design, and helping interpret experimental results in the context of structural models.

What lessons from uppP research can be applied to broader studies of membrane enzymes in bacterial systems?

Research on Acidovorax ebreus uppP and other UPP phosphatases offers valuable insights applicable to membrane enzyme research more broadly:

  • Functional redundancy considerations: The synthetic lethality observed between uppP and bcrC in B. subtilis demonstrates how bacteria often maintain redundant systems for essential functions. This pattern suggests researchers should routinely investigate potential backup systems when studying membrane enzymes, as single gene knockout approaches may not reveal phenotypes due to compensatory mechanisms .

  • Stress response integration: UPP phosphatases connect cell envelope homeostasis with cell envelope stress response (CESR), illustrating how membrane enzymes often serve as sensors and effectors in stress response pathways. This suggests the value of examining membrane enzyme function under various stress conditions rather than just optimal growth conditions .

  • Methodological approaches: The technical challenges encountered in expressing, purifying, and characterizing uppP are common across membrane enzyme research. Successful strategies for uppP—including specialized expression systems, detergent screening, and activity assay development—provide a template for studying other challenging membrane proteins.

  • Structure-function relationships: The distinct roles of different UPP phosphatases in processes like sporulation versus antibiotic resistance demonstrate how subtle structural differences can lead to specialized functions, even among enzymes catalyzing the same reaction. This highlights the importance of detailed structure-function analysis rather than relying solely on sequence homology or enzymatic activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.