Recombinant Acidovorax sp. NADH-quinone oxidoreductase subunit A (nuoA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its implementation.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
nuoA; Ajs_0957; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Acidovorax sp. (strain JS42)
Target Names
nuoA
Target Protein Sequence
MNLDQYLPVLLFILVGIGVGVVPLLLGYVLGPNRPDPAKNSPYECGFEAFEDARMKFDVR
YYLVAILFILFDLEIAFLFPWAVTLQEVGVTGFVAVLVFLAILVVGFAYEWKKGALNWE
Uniprot No.
Target Background
Function
NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the primary electron acceptor. This process couples the redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus conserving redox energy as a proton gradient.
Database Links
KEGG: ajs:Ajs_0957
STRING: 232721.Ajs_0957
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
