Recombinant Acidovorax sp. Probable intracellular septation protein A (Ajs_1675)

Shipped with Ice Packs
In Stock

Description

Functional Role

Ajs_1675 belongs to the YciB family, which is implicated in bacterial cell division and septation. Key functional insights include:

  • Septation Mechanism: Likely facilitates intracellular membrane remodeling during cell division, though experimental validation remains pending .

  • Genomic Context: Co-occurs with genes involved in stress response and antimicrobial compound synthesis in Acidovorax pan-genome analyses .

  • Ecological Adaptation: Acidovorax strains with robust plant-growth promotion traits show enriched genomic features for organic acid metabolism and antimicrobial resistance , suggesting Ajs_1675 may indirectly support niche specialization.

Research Applications

This recombinant protein serves as a tool for:

  • Structural Studies: Investigating membrane protein topology via crystallography or cryo-EM.

  • Interaction Mapping: Identifying binding partners using pull-down assays (e.g., dynein-related proteins) .

  • Comparative Genomics: Serving as a marker to study evolutionary divergence between commensal and pathogenic Acidovorax strains .

Technical Considerations

ParameterRecommendation
StabilityAvoid repeated freeze-thaw cycles; aliquot for long-term storage
Activity AssaysRequires reconstitution in lipid-containing buffers for membrane-associated studies
Commercial AvailabilitySold as ELISA-grade protein (≥90% purity) by multiple vendors

Knowledge Gaps and Future Directions

While Ajs_1675’s sequence and basic biochemical properties are well-defined , its precise mechanistic role in septation remains uncharacterized. Current Acidovorax pan-genome studies highlight correlations between YciB homologs and plant-associated lifestyles , but targeted mutagenesis experiments are needed to establish causality. Future work could explore:

  • Knockout phenotypes in Acidovorax cell division

  • Cross-species functional complementation assays

  • Structural dynamics under varying osmotic conditions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is finalized during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing it.
Synonyms
yciB; Ajs_1675; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Acidovorax sp. (strain JS42)
Target Names
Ajs_1675
Target Protein Sequence
MKLLIDFFPIILFFAAFKVWGIYVATAVAIAATVVQIGYIRLKHGKVEPLQWLSLGVIVL FGGATLLAHSETFIKWKPTVLYWLMGGTLLVGQLVFRKNFIQSLMGAQIDLPAPVWRNLN WGWTGFFATMGVLNLWVAYNFDTDTWVNFKLFGGIGLMFAFVIAQALYLSRHVKDEGDAA PKDLQP
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining the integrity of the cell envelope and ensuring proper membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of intracellular septation protein A in Acidovorax species?

Intracellular septation protein A in Acidovorax species is primarily involved in cell division processes. It plays a critical role in intracellular septation, which is essential for bacterial cell division and proliferation. Similar proteins like the Dtpsy_2029 from Acidovorax ebreus function in cellular division mechanisms by facilitating the formation of septal structures that eventually lead to cell division. The protein is likely conserved across various Acidovorax species with similar functional roles .

Which protein family does Ajs_1675 belong to and what are its key structural features?

Ajs_1675 belongs to the YciB protein family, similar to the homologous Dtpsy_2029 protein found in Acidovorax ebreus. Structurally, these proteins are characterized as multi-pass membrane proteins located in the cell inner membrane. The Acidovorax ebreus homolog has 186 amino acid positions with a molecular weight of approximately 20,942 Da. The protein contains multiple transmembrane domains that anchor it to the cell membrane, which is critical for its septation function .

What expression systems are recommended for producing recombinant Ajs_1675?

For recombinant expression of membrane proteins like Ajs_1675, several expression systems can be considered:

Expression SystemAdvantagesLimitationsBest For
E. coliCost-effective, high yield, rapid growthMay not properly fold complex membrane proteinsInitial screening, high-throughput studies
YeastBetter post-translational modifications, good for membrane proteinsSlower than E. coli, different codon usageFunctional studies requiring proper folding
BaculovirusExcellent for complex eukaryotic proteinsMore expensive, technically demandingStructural studies requiring native conformation
Mammalian cellsBest post-translational modificationsMost expensive, lowest yieldsAdvanced functional studies

Based on information about similar proteins, E. coli is often used as the initial expression host for septation proteins, but researchers should be prepared to optimize or switch systems if proper folding becomes an issue .

What purification strategy should be employed for recombinant Ajs_1675?

Purification of membrane proteins like Ajs_1675 requires specialized approaches:

  • Membrane extraction: Use appropriate detergents (DDM, LDAO, or Triton X-100) to solubilize the protein from membranes

  • Affinity chromatography: Utilize N-terminal or C-terminal affinity tags (His, GST, etc.) for initial capture

  • Size-exclusion chromatography: Further purify based on size to achieve higher purity

  • Consider using specialized techniques for membrane proteins such as amphipol stabilization

The purification protocol should target ≥85% purity as determined by SDS-PAGE for most research applications. For structural studies, higher purity (≥95%) would be recommended .

How can researchers overcome solubility challenges with recombinant Ajs_1675?

Membrane proteins like Ajs_1675 present significant solubility challenges. A methodological approach includes:

  • Truncation strategies: Create constructs lacking hydrophobic regions while preserving functional domains

  • Fusion partners: Use solubility-enhancing tags like MBP, SUMO, or Thioredoxin

  • Detergent screening: Systematically test different detergents (DDM, CHAPS, Fos-choline)

  • Buffer optimization: Screen various pH conditions, salt concentrations, and stabilizing additives

  • Co-expression with chaperones: Use specialized E. coli strains expressing chaperones to assist folding

If persistent solubility issues occur, consider switching to lipid nanodiscs or amphipol systems that better mimic the native membrane environment .

What are the most effective techniques for analyzing the structure of Ajs_1675?

For structural characterization of membrane proteins like Ajs_1675, researchers should consider a multi-technique approach:

For membrane proteins like Ajs_1675, cryo-EM has become increasingly valuable due to difficulties in crystallizing membrane proteins. ModBase computational structure prediction can provide initial structural insights, as mentioned for the homologous protein .

How can researchers predict the transmembrane topology of Ajs_1675?

Predicting the transmembrane topology of Ajs_1675 requires computational and experimental approaches:

Computational methods:

  • Use specialized prediction algorithms (TMHMM, Phobius, TOPCONS)

  • Apply homology modeling based on the YciB family proteins

  • Leverage the ModBase 3D structure available for homologous proteins like B9MAB3 (Acidovorax ebreus)

Experimental validation:

  • PhoA/LacZ fusion analysis to identify membrane-spanning regions

  • Cysteine scanning mutagenesis coupled with accessibility assays

  • Epitope insertion followed by immunofluorescence analysis

  • Limited proteolysis combined with mass spectrometry

A consensus approach combining multiple prediction methods with experimental validation provides the most reliable topology information .

What experimental approaches can be used to investigate the role of Ajs_1675 in cell division?

To investigate the role of Ajs_1675 in cell division, researchers can employ multiple complementary approaches:

  • Gene knockout/knockdown: Create deletion mutants and assess division phenotypes

  • Fluorescent protein tagging: Visualize localization during the cell division cycle

  • Time-lapse microscopy: Monitor septum formation in real-time

  • Protein-protein interaction studies: Identify division proteins that interact with Ajs_1675

  • Site-directed mutagenesis: Target conserved residues to disrupt function

  • Complementation assays: Restore function in deletion strains

These approaches should be combined with quantitative measurements of division parameters (time, morphology, success rate) to fully characterize the protein's role in septation .

How can researchers investigate protein-protein interactions involving Ajs_1675?

Investigating protein-protein interactions for membrane proteins like Ajs_1675 requires specialized approaches:

  • Bacterial two-hybrid systems: Adapted for membrane proteins

  • Co-immunoprecipitation: Using mild detergents to preserve interactions

  • Proximity labeling: BioID or APEX2 to identify proximal proteins in vivo

  • Cross-linking mass spectrometry: To capture transient interactions

  • FRET/BRET analyses: For real-time interaction studies in living cells

  • Surface plasmon resonance: For quantitative binding studies with purified components

When designing these experiments, it's crucial to maintain the native membrane environment or use appropriate membrane mimetics to preserve physiologically relevant interactions .

What methods can be used to assess the impact of mutagenesis on Ajs_1675 function?

A methodological approach to assess mutagenesis effects on Ajs_1675 includes:

  • Conservation analysis: Target residues conserved across YciB family proteins

  • Complementation assays: Test if mutant proteins rescue knockout phenotypes

  • Bacterial growth/division assays: Quantify division rates and morphological changes

  • Protein localization studies: Determine if mutations affect septum localization

  • Stability assessments: Measure protein half-life and expression levels

  • Membrane integration analysis: Verify proper membrane insertion of mutants

Systematic alanine scanning of transmembrane regions can identify critical functional domains. For more targeted approaches, researchers should focus on regions with predicted functional importance based on homology to better-characterized septation proteins .

How can recombination studies inform our understanding of septation protein evolution?

Recombination studies can provide valuable insights into septation protein evolution. Research approaches might include:

  • Comparative genomics: Analyze YciB family genes across bacterial species

  • Phylogenetic analysis: Reconstruct evolutionary relationships of septation proteins

  • Domain swapping experiments: Create chimeric proteins with domains from different species

  • Directed evolution: Select for altered function through iterative mutation/selection

  • Ancestral sequence reconstruction: Infer and test ancestral septation protein sequences

These approaches can help understand how septation mechanisms evolved and potentially identify adaptive changes in different bacterial lineages. The recombination studies methodology described for enteroviruses in the literature might provide technical approaches that could be adapted for studying recombination in bacterial cell division genes .

What are the most common pitfalls in experimental design when working with recombinant septation proteins?

Researchers should be aware of several common pitfalls when designing experiments with recombinant septation proteins:

  • Membrane protein solubility issues leading to aggregation and loss of function

  • Tag interference with native function or localization

  • Expression level artifacts (both over and under-expression)

  • Host-specific differences in lipid composition affecting function

  • Lack of appropriate interaction partners in heterologous systems

  • Improper controls for membrane protein localization studies

To address these challenges, researchers should:

  • Always include both N- and C-terminally tagged versions for comparison

  • Validate function through complementation of knockout strains

  • Use inducible expression systems to control protein levels

  • Consider native vs. heterologous expression carefully

  • Include wild-type controls in all experimental conditions

How can contradictory data regarding Ajs_1675 function be reconciled?

When faced with contradictory data about Ajs_1675 function, researchers should take a systematic approach:

  • Examine experimental conditions: Differences in expression systems, tags, or buffer conditions may explain contradictions

  • Consider organism-specific contexts: Function may vary between Acidovorax species

  • Assess protein interaction networks: Different interaction partners may alter function

  • Evaluate methodological differences: Various techniques have different limitations

  • Design decisive experiments: Create studies specifically to test competing hypotheses

A structured approach to reconciling contradictory data includes:

  • Meta-analysis of published results with attention to methodological differences

  • Collaborative cross-validation between laboratories

  • Development of standardized assays for septation protein function

  • Integration of multiple techniques to build a consensus model of function

What new methodologies might advance research on bacterial septation proteins?

Emerging methodologies that could significantly advance septation protein research include:

  • Cryo-electron tomography: For visualization of septation complexes in near-native states

  • Single-molecule tracking: To monitor septation protein dynamics in living cells

  • Microfluidic-based division assays: For high-throughput phenotypic analysis

  • CRISPR-interference: For precise temporal control of gene expression

  • Expanded genetic code technologies: To incorporate photo-crosslinking amino acids

  • Advanced computational modeling: To predict septation complex assembly and dynamics

These approaches could overcome current limitations in studying transient septation events and provide unprecedented insights into the dynamic behavior of proteins like Ajs_1675 during bacterial cell division .

How can researchers verify the quality and functionality of purified recombinant Ajs_1675?

Verifying the quality and functionality of purified Ajs_1675 requires multiple quality control measures:

  • Purity assessment: SDS-PAGE analysis with target purity ≥85%

  • Western blot: Confirm identity using specific antibodies

  • Mass spectrometry: Verify protein sequence and post-translational modifications

  • Circular dichroism: Assess secondary structure integrity

  • Size-exclusion chromatography: Confirm monodispersity and proper oligomeric state

  • Functional assays: Develop reconstitution systems to test septation activity

  • Thermal stability assays: Determine protein stability under various conditions

The COA, Testing Data, and QC Report mentioned for similar recombinant proteins in the literature provide templates for comprehensive quality control documentation .

What are the best storage conditions for maintaining Ajs_1675 stability?

For optimal stability of recombinant Ajs_1675:

Storage FormTemperatureBuffer RecommendationsAdditivesExpected Stability
Lyophilized-20°C to -80°CNANA1-2 years
Liquid-80°C20mM Tris-HCl pH 7.5, 150mM NaCl5-10% glycerol, 0.02-0.05% detergent6-12 months
Working stock-20°CApplication-dependentApplication-dependent1-3 months

For extended storage, -80°C is recommended, consistent with practices for similar recombinant proteins. When handling the protein, brief centrifugation of the vial is recommended if liquid becomes entrapped in the seal during shipping and storage .

What controls should be included in functional studies of Ajs_1675?

Robust experimental design for functional studies of Ajs_1675 should include:

Positive controls:

  • Wild-type protein expressed under identical conditions

  • Known functional septation proteins from model organisms

  • Positive phenotype controls (normal division patterns)

Negative controls:

  • Empty vector controls

  • Inactive mutant versions (if available)

  • Unrelated membrane proteins of similar size/topology

  • Negative phenotype controls (division defects)

Experimental validation controls:

  • Multiple independent clones/preparations

  • Dose-dependent activity assessment

  • Multiple functional readouts

  • Controls for tag/fusion protein effects

These controls help distinguish specific Ajs_1675 functions from artifacts and provide benchmarks for interpreting experimental results .

How does Ajs_1675 compare with septation proteins in other bacterial species?

Comparative analysis of septation proteins across bacterial species reveals important evolutionary and functional insights:

SpeciesSeptation ProteinIdentity to Ajs_1675Key DifferencesFunctional Implications
Acidovorax ebreusDtpsy_2029High (estimated >80%)Minor variations in transmembrane domainsSimilar septation function
E. coliYciBModerateDifferent C-terminal regionPotentially altered protein interactions
B. subtilisDivICLowDifferent domain organizationDivergent septation mechanisms
P. aeruginosaYciB homologModerateSpecies-specific insertionsAdaptation to different cell shapes

This comparative analysis helps researchers predict functional regions and design experiments targeting conserved domains. The YciB family membership of proteins like Dtpsy_2029 suggests similar membrane topology and functional roles across species .

What insights can be gained from studying homologous proteins in model organisms?

Studying homologous septation proteins in model organisms provides several advantages:

  • Access to established genetic tools and resources

  • Better characterized cell division machinery

  • More extensive literature on protein-protein interactions

  • Availability of antibodies and validated assays

  • Opportunity to leverage existing mutant collections

Research strategies should include:

  • Complementation studies: Test if Ajs_1675 can rescue defects in model organism septation mutants

  • Localization comparisons: Determine if localization patterns are conserved

  • Interaction partner identification: Compare protein-protein interaction networks

  • Functional domain mapping: Identify conserved functional regions through comparative analysis

These approaches can accelerate understanding of Ajs_1675 function by building on the extensive knowledge base available for model organisms .

What are the most promising areas for future research on bacterial septation proteins?

The most promising future research directions for bacterial septation proteins like Ajs_1675 include:

  • Antimicrobial development: Targeting essential septation processes for new antibiotics

  • Synthetic biology applications: Engineering division mechanisms for artificial cells

  • Evolutionary studies: Understanding adaptations in division mechanisms

  • Systems biology: Mapping the complete septation interactome

  • Structural biology: Determining high-resolution structures of septation complexes

  • Single-cell dynamics: Real-time visualization of septation protein assembly

Each direction offers unique opportunities to advance both fundamental understanding and practical applications of septation protein research. The integration of genetic recombination approaches with advanced imaging techniques could be particularly powerful for dissecting complex septation mechanisms .

How might advanced genetic techniques contribute to understanding Ajs_1675 function?

Advanced genetic techniques offer powerful approaches to understanding Ajs_1675 function:

  • CRISPR-Cas9 genome editing:

    • Generate precise knockouts and point mutations

    • Create fluorescent protein fusions at endogenous loci

    • Implement CRISPRi for tunable repression

  • Directed evolution approaches:

    • Develop selection systems for improved or altered function

    • Screen randomized libraries for structure-function insights

    • Evolve protein variants with novel properties

  • Deep mutational scanning:

    • Systematically assess thousands of mutations simultaneously

    • Create comprehensive maps of functional residues

    • Identify subtle effects missed by traditional approaches

  • Recombination-based approaches:

    • Study the biphasic process of genetic recombination

    • Investigate the role of polymerase fidelity in recombination frequency

    • Apply insights from enterovirus recombination studies to bacterial systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.