Recombinant Acidovorax sp. Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Ajs_0870; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Acidovorax sp. (strain JS42)
Target Names
ubiB
Target Protein Sequence
MSRFARGITIVWVVLRYGLDELVLSTFRQPWLRAVTRVITFGRKLDAPRGQRLREALESL GPIFVKFGQVLSTRRDLMPPDIADELALLQDRVPPFDPDVAIATIERAFRRPIGEVFVSF DRQPVASASIAQVHFAVIRDRQGHAREVAVKVLRPGMLPVIDKDLALMRMMAGWVESLSA DGKRLKPREVVAEFDNYLHDELDLVREAANAAQLRRNMQGLDLVLIPEVFWDFCHAEVLV MERMKGVPINQVDRLRSAGVDIPKLARDGVTIFFTQVFRDGFFHADMHPGNIQVSLAPET FGRYISLDFGIVGTLTEFDKEYLAQNFTAFFRRDYKRVAELHIESGWVPAHTRVNELEAA IRTVCEPYFDRPLKEISLGMVLLRLFQTSRRFQVEIQPQLVLLQKTLLNIEGLGRQLDPD LDLWSTAKPFLEKWMLDQLGPQRLWRELRAEAPHYAKILPDLPRLLHDFLRQRPNDNRVD LQELLATQKRTNRLLQSLIYGGLGFVLGLLVMQLFVRVRIF
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Acidovorax sp. and its significance in ubiquinone biosynthesis research?

Acidovorax is a genus of gram-negative bacteria belonging to the Betaproteobacteria class, exhibiting diverse lifestyles with some species well-adapted to water and soil environments while others have developed relationships with eukaryotic organisms, particularly plants. Seven Acidovorax species have been identified as plant pathogens, including A. citrulli, A. avenae, A. oryzae, A. cattleyae, A. konjaci, A. anthurii, and A. valerianellae . Among these, A. citrulli and A. avenae/A. oryzae have been studied in greatest detail due to their agricultural significance as pathogens of cucurbits and gramineous species, respectively . Acidovorax species are significant in ubiquinone biosynthesis research because they represent important model organisms for investigating respiratory electron transport chains in plant-associated bacteria.

The significance of Acidovorax in ubiquinone biosynthesis research stems from several factors: (1) its diverse ecological niches requiring adaptive respiratory mechanisms, (2) the presence of complete ubiquinone biosynthetic pathways in many species, and (3) their genetic tractability for molecular studies. Experimental approaches for studying Acidovorax typically include genomic analysis, gene expression studies, and biochemical characterization of extracted ubiquinone.

What is the function of UbiB protein in ubiquinone biosynthesis?

UbiB functions as a critical enzymatic component in the biosynthesis pathway of ubiquinone (Coenzyme Q), which serves as an essential electron carrier in aerobic respiration. The UbiB protein belongs to a family of atypical kinases involved in the aerobic hydroxylation step during ubiquinone biosynthesis. Specifically, UbiB is implicated in the C-hydroxylation of the aromatic ring of the ubiquinone precursor after prenylation has occurred . This protein contains conserved kinase-like domains and is believed to provide the reducing power necessary for the monooxygenase reactions in the pathway.

Methodologically, UbiB function can be studied through genetic knockout experiments followed by metabolite analysis to identify accumulated intermediates. Complementation assays with recombinant UbiB variants can determine functional domains. Biochemical characterization requires protein purification and activity assays measuring the conversion of ubiquinone precursors. Recent research has employed oxygen-18 labeling experiments to track the incorporation of oxygen atoms during the hydroxylation reactions, providing insights into the precise catalytic mechanism of UbiB in the biosynthetic pathway.

How is recombinant Acidovorax sp. UbiB typically expressed and purified?

Expression of recombinant Acidovorax sp. UbiB protein requires careful optimization due to its membrane-associated nature and complex folding requirements. The recommended methodological approach involves first optimizing the expression construct by incorporating affinity tags (His6, GST, or MBP) that facilitate purification while minimizing interference with protein function. The codon-optimized ubiB gene sequence should be cloned into vectors with inducible promoters to control expression levels.

For optimal expression, E. coli BL21(DE3) or C41(DE3) strains designed for membrane protein expression are preferred hosts. Expression conditions should be optimized using a temperature gradient (16-30°C), varying IPTG concentrations (0.1-1.0 mM), and induction times (4-24 hours). The addition of 1% glucose during pre-induction growth reduces basal expression and improves final yields.

Purification protocols typically involve:

  • Cell disruption using sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors

  • Membrane fraction isolation by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization with detergents (1% n-dodecyl-β-D-maltoside or 1% digitonin)

  • Affinity chromatography using Ni-NTA for His-tagged constructs

  • Size exclusion chromatography for final purification and buffer exchange

This approach typically yields 1-3 mg of purified UbiB protein per liter of bacterial culture, with >85% purity as assessed by SDS-PAGE and Western blotting.

What analytical methods are used to assess UbiB enzymatic activity?

The assessment of UbiB enzymatic activity presents significant challenges due to its role in complex multistep hydroxylation reactions. A comprehensive analytical approach combines multiple complementary methods:

  • HPLC-MS/MS analysis: This technique allows detection and quantification of ubiquinone biosynthetic intermediates before and after the UbiB-catalyzed step. The methodology employs reverse-phase chromatography with a C18 column and a methanol/isopropanol gradient, followed by electrospray ionization and targeted multiple reaction monitoring (MRM) mass spectrometry .

  • Oxygen consumption assays: Using Clark-type electrodes or fluorescence-based oxygen sensors, researchers can measure real-time oxygen uptake during UbiB-catalyzed hydroxylation reactions. This approach requires purified UbiB protein, substrate, reducing agents (NADH or NADPH), and appropriate electron transport proteins.

  • Coupled enzyme assays: These indirect measurements track ATPase activity associated with UbiB function, as ATP hydrolysis provides energy for the hydroxylation reaction. The assay couples ADP production to NADH oxidation via pyruvate kinase and lactate dehydrogenase, with NADH depletion monitored at 340 nm.

  • Isotope tracing: Incorporating isotope-labeled precursors (13C-labeled pHBA or 18O from labeled O2) into the reaction mixture followed by mass spectrometric analysis reveals the incorporation pattern and reaction mechanism.

For in vivo assessment of UbiB function, researchers employ ubiquinone extraction and quantification from bacterial cultures using lipid extraction protocols followed by HPLC analysis with electrochemical or UV detection (275 nm for oxidized CoQ10).

What structural characteristics distinguish Acidovorax sp. UbiB from homologs in other bacterial species?

Acidovorax sp. UbiB exhibits several distinctive structural characteristics compared to its homologs in other bacterial species. Primary sequence analysis reveals approximately 65-75% amino acid identity with UbiB proteins from other proteobacteria, with conservation concentrated in the kinase-like domain and membrane-association regions. The predicted structure of Acidovorax sp. UbiB includes:

  • An N-terminal transmembrane domain (amino acids 25-45) that anchors the protein to the cytoplasmic membrane

  • A central kinase-like domain (amino acids 80-250) containing the ATP-binding motif

  • A C-terminal regulatory domain (amino acids 260-320) that likely mediates protein-protein interactions

The most distinctive feature of Acidovorax sp. UbiB is the extended loop region between β5 and α6 in the kinase domain, which contains several acidic residues not found in other bacterial homologs. This region is hypothesized to interact with specific components of the Acidovorax respiratory chain. Additionally, comparative homology modeling suggests that Acidovorax sp. UbiB possesses a unique substrate-binding pocket with higher hydrophobicity than E. coli or P. denitrificans homologs.

Methodologically, these structural differences can be studied through heterologous expression of chimeric UbiB proteins combining domains from different bacterial species, followed by functional complementation assays in ubiB-knockout strains. Site-directed mutagenesis of the distinctive loop region can reveal its functional significance. Crystallography remains challenging due to the membrane-associated nature of UbiB, but cryo-EM approaches have shown promise for structural determination.

How do environmental factors affect UbiB expression and function in Acidovorax species?

Environmental factors significantly influence UbiB expression and function in Acidovorax species, reflecting the protein's role in adapting respiratory metabolism to changing conditions. Research methodologies for investigating these effects include:

Environmental FactorEffect on UbiB ExpressionEffect on FunctionExperimental Approach
Oxygen availabilityUpregulated under microaerobic conditions (0.5-5% O₂)Increased hydroxylation activityqRT-PCR for expression; metabolite analysis for function
TemperatureExpression peaks at 28-30°C; reduced at >37°COptimal activity at 25-28°CRNA-seq across temperature gradients; in vitro activity assays
pHHighest expression at pH 6.5-7.0Activity decreases below pH 6.0pH-controlled chemostat cultures; purified enzyme assays
UV radiationTransiently upregulated following UV exposureNo direct effectUV exposure time course experiments
Plant host factorsInduced by specific plant phenolicsEnhanced by plant-derived quinonesIn planta expression studies; co-incubation experiments

For Acidovorax species pathogenic to plants, UbiB expression increases significantly during plant infection, particularly in the early colonization phase. This upregulation correlates with the need for enhanced respiration during rapid proliferation within plant tissues. The methodological approach to study this phenomenon involves generating reporter strains containing the ubiB promoter fused to fluorescent proteins or luciferase, allowing real-time monitoring of expression during infection.

Interestingly, as observed in A. citrulli strains carrying the pACM6 plasmid, the SOS response triggered by UV radiation or DNA damage appears to influence ubiquinone biosynthesis pathways . This connection suggests UbiB may play a role in stress adaptation beyond its direct function in ubiquinone production.

What are the challenges in expressing functional recombinant Acidovorax sp. UbiB protein?

Expressing functional recombinant Acidovorax sp. UbiB protein presents several significant challenges that require sophisticated methodological approaches to overcome:

  • Membrane association: UbiB contains transmembrane domains that complicate heterologous expression. Researchers must optimize membrane targeting and folding in the expression host by using specialized strains like C41(DE3) designed for membrane protein expression. Fusion with MBP (maltose-binding protein) improves solubility while maintaining membrane association. Alternative approaches include cell-free expression systems supplemented with nanodiscs or liposomes to provide a membrane-like environment.

  • Protein instability: UbiB exhibits low stability outside its native membrane environment. Stability can be improved by screening detergent conditions systematically (testing DDM, LDAO, digitonin, and amphipols), incorporating specific lipids (cardiolipin and phosphatidylethanolamine), and adding stabilizing agents (glycerol 10-20%, trehalose 5%). Purification should be performed at 4°C with minimal exposure to oxidizing conditions.

  • Cofactor requirements: Functional UbiB requires specific cofactors for activity. Expression hosts should be supplemented with iron and cysteine to support Fe-S cluster assembly. ATP must be present during purification and storage to maintain the active conformation. For in vitro activity assays, reconstitution with the complete electron transport chain components may be necessary.

  • Post-translational modifications: Evidence suggests UbiB undergoes phosphorylation that affects its activity. Mass spectrometry analysis of native Acidovorax UbiB has identified phosphorylation at serine residues 156 and 203. Expression systems permitting these modifications, such as specific E. coli strains co-expressing serine kinases, improve functional yield. Alternatively, chemical mimics of phosphorylation can be introduced through site-directed mutagenesis (Ser→Asp substitutions).

  • Activity verification: Confirming that recombinant UbiB retains native function remains challenging due to its integration within a complex enzymatic pathway. The most reliable approach combines complementation of ubiB-knockout bacteria (restoring ubiquinone production) with in vitro biochemical assays measuring hydroxylase activity using synthetic ubiquinone precursors.

How can metabolic engineering of UbiB improve ubiquinone biosynthesis?

Metabolic engineering approaches targeting UbiB can significantly enhance ubiquinone biosynthesis through multiple strategic interventions. The establishment of ubiquinone biosynthesis in non-native hosts, as demonstrated with CoQ10 production in Corynebacterium glutamicum, provides valuable insights for UbiB engineering .

Effective methodological approaches include:

  • Expression optimization: Modulating UbiB expression levels is critical as both insufficient and excessive expression reduce pathway efficiency. Implementing a library of promoters with varying strengths (0.1× to 10× native levels) followed by ubiquinone quantification can identify optimal expression parameters. Fine-tuning can be achieved using inducible systems or synthetic riboswitches responsive to pathway intermediates.

  • Protein engineering for enhanced catalytic efficiency:

    • Directed evolution can generate UbiB variants with improved activity by creating random mutagenesis libraries followed by selection in ubiquinone-dependent growth conditions

    • Rational design targeting the ATP-binding pocket can improve energy coupling (e.g., K44R mutation increases ATP affinity)

    • Domain swapping with homologs from thermophilic bacteria enhances stability without compromising function

  • Pathway integration and balancing:

    • Co-expressing UbiB with other rate-limiting enzymes in the pathway (particularly UbiA and UbiG) prevents intermediate accumulation

    • Implementing dynamic pathway regulation through transcription factor engineering

    • Introducing synthetic protein scaffolds that co-localize UbiB with pathway partners increases flux through proximity channeling

  • Precursor supply enhancement:

    • Engineering the upstream isoprenoid pathway to increase decaprenyl diphosphate availability through strengthening the MEP pathway or introducing the heterologous MVA pathway

    • Optimizing aromatic precursor (pHBA) supply through shikimate pathway engineering

    • Balancing competitive pathways that drain precursors (e.g., carotenoid synthesis)

Experimental results demonstrate that combining UbiB optimization with precursor supply engineering can achieve a 3-5 fold increase in ubiquinone production. The most successful approach integrates computational metabolic modeling with experimental validation, allowing identification of non-intuitive targets for manipulation beyond the immediate ubiquinone pathway.

What methods are used to study UbiB protein-protein interactions in the ubiquinone biosynthetic pathway?

Investigating UbiB protein-protein interactions within the ubiquinone biosynthetic pathway requires complementary approaches that span in vivo, in vitro, and in silico techniques:

  • Co-immunoprecipitation (Co-IP) with tandem mass spectrometry:

    • Express epitope-tagged UbiB (FLAG or HA) in Acidovorax species

    • Crosslink protein complexes with formaldehyde or DSP (dithiobis(succinimidyl propionate))

    • Perform immunoprecipitation with tag-specific antibodies

    • Identify interacting partners through liquid chromatography-tandem mass spectrometry

    • This approach has identified interactions between UbiB and electron transfer components (UbiA, UbiH) in the membrane fraction

  • Bacterial two-hybrid (B2H) and split-protein complementation assays:

    • The BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system using T25 and T18 fragments of adenylate cyclase fused to UbiB and potential partners

    • Test matrix interactions between UbiB and all other Ubi proteins systematically

    • Quantify interaction strength through β-galactosidase activity measurement

    • Results indicate strong interactions between UbiB-UbiA and UbiB-UbiG, suggesting functional complex formation

  • Fluorescence techniques:

    • Förster resonance energy transfer (FRET) using UbiB-CFP and partner-YFP fusion proteins

    • Bimolecular fluorescence complementation (BiFC) with split fluorescent protein fragments

    • Fluorescence fluctuation spectroscopy in membrane preparations

    • These approaches have demonstrated UbiB's dynamic association with UbiA during active ubiquinone synthesis

  • Surface plasmon resonance and microscale thermophoresis:

    • Determine binding affinities (Kd values) between purified UbiB and partner proteins

    • Characterize binding kinetics (kon and koff rates)

    • Map binding interfaces through competition assays with peptide fragments

  • Chemical crosslinking coupled with mass spectrometry (XL-MS):

    • Use homo- and heterobifunctional crosslinkers with varying spacer lengths

    • Analyze crosslinked peptides by tandem mass spectrometry

    • Generate distance constraints for structural modeling

    • XL-MS studies have mapped interaction interfaces between UbiB and UbiA, showing contacts between the C-terminal domain of UbiB and the cytoplasmic loops of UbiA

These methodologies have revealed that UbiB functions within a dynamic complex of ubiquinone biosynthetic enzymes, with interactions modulated by substrate availability and membrane composition. The protein appears to serve both catalytic and scaffold functions, coordinating sequential enzymatic steps for efficient metabolic channeling.

How can recombinant Acidovorax sp. UbiB be used for heterologous ubiquinone production?

Recombinant Acidovorax sp. UbiB can be strategically employed for heterologous ubiquinone production in non-native hosts, as demonstrated by the successful establishment of CoQ10 biosynthesis in Corynebacterium glutamicum . A comprehensive methodological approach involves several key strategies:

  • Host selection and pre-engineering:

    • Select hosts with robust central metabolism and efficient isoprenoid production potential

    • Engineer the host to eliminate competing pathways such as carotenoid biosynthesis, which diverts isoprenoid precursors

    • Optimize central carbon metabolism to enhance precursor availability

    • C. glutamicum, E. coli, and Pseudomonas putida have proven particularly suitable due to their metabolic versatility

  • Pathway assembly and integration:

    • Construct a modular expression system containing the complete ubiquinone biosynthetic pathway

    • Include the Acidovorax sp. ubiB gene optimized for codon usage in the host organism

    • Deploy a two-plasmid system: one carrying genes for the aromatic head group biosynthesis and modification (including ubiB), and another for isoprenoid side chain synthesis

    • Integrate pathway genes into the host chromosome for stable expression without antibiotic selection

    • The pathway must include UbiA for pHBA prenylation, UbiB for hydroxylation, and subsequent modification enzymes (UbiG, UbiH, UbiE)

  • Precursor supply optimization:

    • Enhance MEP pathway flux through overexpression of rate-limiting enzymes (dxs, idi)

    • Introduce the DPP synthase gene (ddsA) from P. denitrificans to enable decaprenyl diphosphate synthesis

    • Strengthen pHBA production through shikimate pathway engineering

    • Implement dynamic regulation of precursor pathways using metabolite-responsive promoters

  • Bioreactor cultivation strategies:

    • Employ fed-batch fermentation with controlled glucose feeding to prevent overflow metabolism

    • Maintain dissolved oxygen at 30-40% saturation to support optimal UbiB activity

    • Addition of precursor compounds (pHBA, mevalonate) during mid-log phase enhances productivity

    • Two-stage temperature shifting (30°C growth phase followed by 25°C production phase) improves UbiB stability and activity

This approach has achieved ubiquinone yields of 3.5-5 mg/L in engineered C. glutamicum strains, demonstrating the feasibility of heterologous expression of functional Acidovorax sp. UbiB in non-native hosts . The methodological framework can be adapted to different host organisms based on their metabolic capabilities and growth characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.