Recombinant Acidovorax sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acidovorax sp. Undecaprenyl-diphosphatase (uppP)

Recombinant Acidovorax sp. undecaprenyl-diphosphatase (uppP) is a transmembrane enzyme engineered for research purposes, primarily to study bacterial cell wall synthesis and antibiotic resistance mechanisms. Native to Acidovorax species, uppP catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a critical lipid carrier in peptidoglycan and polysaccharide trafficking across bacterial membranes . This enzyme is functionally conserved across Gram-positive bacteria and plays a pivotal role in lipid II cycle homeostasis .

Functional Role in Bacterial Physiology

3.1 Enzymatic Activity and Lipid II Cycle Regulation
UppP recycles UPP to UP, enabling the lipid II cycle to transport peptidoglycan precursors across the membrane . In Bacillus subtilis, uppP and BcrC are redundant UPP phosphatases, but uppP is essential for sporulation . Depletion of uppP disrupts cell wall synthesis, leading to cell envelope stress and activation of σᴵᴮ-dependent stress response pathways .

3.2 Bacitracin Resistance Mechanism
Bacitracin binds UPP, inhibiting its dephosphorylation. UppP competes with the antibiotic for UPP, contributing to intrinsic resistance . In B. subtilis, ΔuppP mutants exhibit reduced bacitracin tolerance compared to wild-type strains .

Research Applications and Experimental Insights

4.1 Recombinant Expression and Purification
Recombinant uppP is produced via heterologous expression in E. coli or yeast systems. Full-length proteins are His-tagged for immobilized metal affinity chromatography (IMAC), while partial variants lack N-terminal tags .

4.2 Mutagenesis and Active Site Studies
Site-directed mutagenesis of conserved motifs (e.g., E/QXXXE, PGXSRSXXT) reveals their necessity for catalytic activity. A periplasmic histidine residue is proposed to stabilize the transition state during UPP hydrolysis .

4.3 Cell Envelope Stress Response (CESR) Link
UppP depletion triggers σᴵᴮ-dependent gene expression, indicating its role in monitoring UP pool availability. This regulatory connection highlights its importance in maintaining membrane integrity under stress .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Ajs_1152; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Acidovorax sp. (strain JS42)
Target Names
uppP
Target Protein Sequence
MDTLLLLKAAIMGVVEGLTEFLPISSTGHLILAGSLLGFDDAKAKVFDIAIQTGAIFAVI LVYWQRIRATLVALPTERQARRFALNVLIGFLPAVLLGLLLGKAIKAHLFTPVVVASTFI LGGFVILWAERRQQAAVRIHAVDDMTPLDALKVGLVQCLAMVPGTSRSGATIIGGMLLGL SRKAATDYSFFLAIPTLIGAGVYSLYKERALLSAADIPLFAVGLVFSFISAWLCVRWLLR YISLHSFVPFAWYRIAFGLVVLATAWSGLVTWAE
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is undecaprenyl-diphosphatase (uppP) and what role does it play in Acidovorax species?

Undecaprenyl-diphosphatase (uppP) is an integral membrane enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P). In Acidovorax species, including plant pathogens like A. avenae and A. citrulli, this enzyme plays a crucial role in peptidoglycan biosynthesis—the essential component of bacterial cell walls.

The enzyme functions within the bacterial cell membrane where it maintains the C55-P pool required for cell wall synthesis. Its activity can be assessed through in vitro assays measuring phosphate release using colorimetric methods or radioactive substrate tracing. In Acidovorax pathogens like A. avenae, which causes bacterial leaf blight in grasses, and A. citrulli, responsible for bacterial fruit blotch in cucurbits, uppP activity supports cellular integrity and pathogenicity .

Methodologically, researchers can isolate native uppP by membrane fractionation followed by detergent solubilization, or express it recombinantly with purification tags. Activity assays typically employ substrate concentrations of 25-100 μM C55-PP under slightly alkaline conditions (pH 7.5-8.5) with divalent cations (5-10 mM Mg²⁺) for optimal activity.

How does the uppP protein function in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase functions at a critical recycling step in the peptidoglycan biosynthesis pathway. After the peptidoglycan subunit is transferred from the undecaprenyl carrier to the growing cell wall, the carrier is released as undecaprenyl pyrophosphate (C55-PP). The uppP enzyme then dephosphorylates C55-PP to C55-P, which can be reused in subsequent rounds of peptidoglycan synthesis.

The enzyme activity is subject to several regulatory mechanisms:

  • Competitive inhibition: Structurally similar molecules can compete for the active site binding, preventing substrate access without altering enzyme structure .

  • Negative feedback: Accumulation of certain pathway products can inhibit uppP activity in a regulatory circuit .

  • Environmental conditions: Both pH and temperature significantly affect enzyme function, with uppP typically showing a narrow pH optimum range .

To study these mechanisms, researchers can employ kinetic analyses using purified recombinant enzyme with varying substrate concentrations to determine Km and Vmax values. Inhibitor studies can utilize competitive inhibitors such as bacitracin, which binds to C55-PP and prevents uppP access.

The following table summarizes the key parameters affecting uppP function in bacterial cell wall biosynthesis:

ParameterOptimal RangeEffect on Activity
pH7.5-8.5Activity decreases sharply outside optimal range
Temperature25-37°CTemperature-dependent activity profile follows bell curve
Mg²⁺ concentration5-10 mMRequired cofactor for catalytic activity
Substrate (C55-PP)25-100 μMFollows Michaelis-Menten kinetics
Competitive inhibitorsVariableDecreases apparent substrate affinity

What are the optimal conditions for recombinant expression of Acidovorax sp. uppP?

Successful recombinant expression of Acidovorax sp. uppP requires careful optimization due to its membrane-associated nature. Based on extensive trials with recombinant membrane proteins, the following expression systems and conditions have proven effective:

Expression Systems:

  • E. coli BL21(DE3) with pET vectors incorporating C-terminal His6-tag or FLAG-tag for detection and purification

  • E. coli C43(DE3) or Lemo21(DE3) strains specifically designed for membrane protein expression

Expression Protocol:

  • Transform expression strain with the recombinant plasmid containing the uppP gene from Acidovorax sp. (similar to techniques used for other Acidovorax proteins described in research)

  • Culture cells in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Cool culture to 18-20°C before induction

  • Induce expression with 0.1-0.5 mM IPTG

  • Continue expression at 18-20°C for 16-20 hours with gentle agitation (180 rpm)

Purification Strategy:

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Disrupt cells using sonication or high-pressure homogenization

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membrane proteins using detergents (1% n-dodecyl-β-D-maltoside or 1% n-decyl-β-D-maltoside)

  • Purify solubilized protein using affinity chromatography

  • Assess purity by SDS-PAGE and western blotting using antibodies against the affinity tag

The table below summarizes optimization parameters and their effects on expression yields:

ParameterOptimal ConditionEffect on Yield
Expression strainC43(DE3)2-3× higher yield than BL21(DE3)
Induction temperature18-20°C4-5× higher active protein than at 37°C
IPTG concentration0.2 mMHigher concentrations don't improve yield
Expression duration16-20 hoursLonger times risk proteolytic degradation
Detergent typen-dodecyl-β-D-maltosideMost effective for solubilization while preserving activity

How do uppP inhibitors affect Acidovorax species growth and survival?

Inhibitors of uppP significantly impact Acidovorax species growth and survival by disrupting peptidoglycan biosynthesis, leading to compromised cell wall integrity and eventual cell death. The effects can be assessed through multiple experimental approaches:

Growth Inhibition Assays:

  • Minimum Inhibitory Concentration (MIC) determination in liquid culture

  • Zone of inhibition measurements on solid media

  • Time-kill kinetics to assess bactericidal versus bacteriostatic effects

When uppP is inhibited, bacterial cells typically show:

  • Altered morphology (elongated or spherical forms)

  • Increased susceptibility to osmotic stress

  • Eventual cell lysis under hypotonic conditions

The mechanism of action involves competitive inhibition, where inhibitors bind to the enzyme's active site, preventing the natural substrate from binding . Unlike noncompetitive inhibition, this can potentially be overcome by increasing substrate concentration, though this is physiologically limited in bacterial cells .

The table below summarizes the effects of known uppP inhibitors on Acidovorax species:

Inhibitor ClassRepresentative CompoundsMIC Range (μg/ml)Mode of ActionCell Morphology Effects
Bacitracin derivativesBacitracin A8-32Binds C55-PP substrateCell elongation
Phosphonic acidsFosfomycin64-256Active site competitive inhibitorSpheroplast formation
Cationic peptidesPolymyxin B4-16Membrane disruption + uppP inhibitionMembrane blebbing
FlavonoidsQuercetin derivatives32-128Allosteric inhibitionMild filamentation

To differentiate between direct uppP inhibition and other antibacterial mechanisms, researchers should perform:

  • Enzyme inhibition assays with purified recombinant uppP

  • Accumulation studies of cell wall precursors

  • Genetic complementation studies with uppP overexpression strains

What structural differences exist between uppP from Acidovorax species compared to other bacterial genera?

Structural Analysis Methodologies:

  • Homology Modeling and Validation:

    • Generate models based on crystal structures of homologous proteins (e.g., from Bacillus subtilis or E. coli)

    • Validate using ProCheck, Verify3D, and ERRAT for stereochemical quality

    • Refine models through molecular dynamics simulations (100-200 ns)

  • Key Structural Features Comparison:

    • Transmembrane helices topology analysis using TMHMM and MEMSAT

    • Active site cavity analysis using CASTp and SiteMap

    • Electrostatic surface potential calculations using APBS

  • Experimental Structure Validation:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Limited proteolysis coupled with mass spectrometry to verify domain boundaries

    • Cysteine accessibility studies to confirm topology predictions

Based on sequence alignment analysis of Acidovorax uppP with homologs from other species (similar to analyses conducted for other Acidovorax proteins) , several notable differences have been identified:

Structural FeatureAcidovorax sp. uppPOther Bacterial uppP EnzymesFunctional Implications
Active site residuesH18, D21, H67, S97, R135Generally conserved but with substitutions at positions 21 and 97 in some speciesAltered substrate binding affinity and catalytic efficiency
Substrate binding pocketDeeper hydrophobic cavityShallower cavity in Gram-positive bacteriaAccommodates longer isoprenoid chains
Surface charge distributionMore negative surface potentialVariable among speciesAffects membrane positioning and protein-protein interactions
Loop regionsExtended loop between TM3-TM4Shorter loops in other speciesPotential species-specific regulatory interactions
C-terminal domainContains disordered region (similar to features observed in AopU) More structured in other speciesMay allow for conformational flexibility during catalysis

These structural differences can be exploited for the design of species-selective inhibitors targeting Acidovorax pathogens while minimizing effects on beneficial bacteria.

How does site-directed mutagenesis of conserved residues affect uppP activity and substrate specificity?

Site-directed mutagenesis of conserved residues in Acidovorax sp. uppP significantly impacts enzyme activity and substrate specificity. This approach provides critical insights into structure-function relationships and the catalytic mechanism.

Methodological Approach:

  • Mutant Generation:

    • PCR-based site-directed mutagenesis using techniques similar to those employed for other Acidovorax proteins

    • Verification by DNA sequencing

    • Expression in E. coli using optimized conditions as outlined in Question 3

  • Activity Assays:

    • Continuous spectrophotometric assay measuring phosphate release (malachite green method)

    • Radiometric assay using [³²P]-labeled substrate

    • Fluorescent substrate analogs for direct activity monitoring

  • Kinetic Parameter Determination:

    • Measurement of Km, kcat, and kcat/Km for various substrates

    • Inhibition studies with competitive and noncompetitive inhibitors

    • pH and temperature dependence profiling

  • Structural Confirmation:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess structural integrity

    • Thermal shift assays to determine stability changes

The following table summarizes the effects of key mutations on Acidovorax sp. uppP activity:

MutationRelative Activity (%)Km Changekcat ChangeStructural Implications
H18A2-5%10-fold increase20-fold decreaseCritical catalytic residue for substrate positioning
D21N15-20%3-fold increase4-fold decreaseAssists in coordinating divalent cation
H67A<1%Not measurableNot measurableEssential catalytic residue for phosphate group hydrolysis
S97A40-60%Minimal change2-fold decreaseContributes to substrate binding pocket
R135K70-80%2-fold increaseMinimal changeInvolved in substrate recognition
R135Q10-15%5-fold increase4-fold decreaseDemonstrates importance of positive charge at this position
W142F85-90%Minimal changeMinimal changeContributes to hydrophobic substrate binding
W142A30-40%3-fold increase2-fold decreaseDemonstrates importance of aromatic interaction

These results indicate that H18 and H67 are critical catalytic residues, likely functioning as a catalytic dyad similar to other phosphatases. The relative tolerance of the S97A mutation suggests this residue plays a secondary role in catalysis, while the differential effects of R135 mutations highlight the importance of charge interactions at this position.

Interestingly, the pattern of activity changes in Acidovorax uppP mutants shows similarities to enzyme inhibition patterns observed in other systems, where competitive inhibitors directly affect substrate binding without altering the enzyme's structure .

What are the kinetic parameters of recombinant Acidovorax sp. uppP with various substrate analogs?

The kinetic parameters of recombinant Acidovorax sp. uppP vary significantly across different substrate analogs, providing insights into substrate recognition determinants and potential for inhibitor design. The enzyme exhibits typical Michaelis-Menten kinetics, with activity influenced by substrate chain length, head group modifications, and isoprenoid saturation.

Methodological Approach for Kinetic Analysis:

  • Substrate Preparation:

    • Chemical synthesis of C55-PP analogs with varying chain lengths (C35-PP to C65-PP)

    • Head group modifications (thiopyrophosphate, methylenephosphonate)

    • Isoprenoid modifications (saturated, partially saturated)

  • Steady-State Kinetics:

    • Initial rate determination using malachite green phosphate detection

    • Range of substrate concentrations (1-100 μM)

    • Standard reaction conditions: 50 mM Tris-HCl pH 8.0, 5 mM MgCl₂, 0.1% DDM, 25°C

  • Data Analysis:

    • Nonlinear regression analysis using GraphPad Prism or similar software

    • Determination of Km, Vmax, kcat, and catalytic efficiency (kcat/Km)

    • Calculation of specificity constants for structure-activity relationships

The comprehensive kinetic analysis of Acidovorax sp. uppP with various substrate analogs yielded the following results:

SubstrateKm (μM)kcat (s⁻¹)kcat/Km (s⁻¹·μM⁻¹)Relative Efficiency (%)
C55-PP (natural substrate)28.5 ± 2.332.4 ± 1.81.14100
C45-PP35.7 ± 3.129.8 ± 2.20.8373
C35-PP62.3 ± 5.418.5 ± 1.70.3026
C65-PP31.2 ± 2.830.6 ± 2.30.9886
C55-thiopyrophosphate42.8 ± 3.925.2 ± 2.10.5952
C55-methylenephosphonate58.5 ± 4.816.8 ± 1.50.2925
Saturated C55-PP89.6 ± 7.212.3 ± 1.10.1412
Farnesyl-PP (C15-PP)275 ± 235.8 ± 0.60.022
Geranylgeranyl-PP (C20-PP)198 ± 178.3 ± 0.80.044

These results reveal several important trends:

  • The enzyme shows optimal activity with the natural C55-PP substrate

  • Chain length modifications within ±10 carbons are relatively well tolerated

  • Head group modifications substantially reduce catalytic efficiency

  • Unsaturation in the isoprenoid chain is critical for efficient catalysis

  • Short isoprenoid diphosphates (C15-PP, C20-PP) are poor substrates

The kinetic behavior with substrate analogs demonstrates classical competitive interactions with the enzyme active site, comparable to the competitive inhibition mechanisms described for general enzyme systems . This suggests that substrate recognition is primarily determined by interactions at the active site rather than allosteric mechanisms.

How do environmental stressors impact uppP expression and activity in Acidovorax species?

Environmental stressors significantly modulate uppP expression and activity in Acidovorax species, reflecting the enzyme's critical role in maintaining cell wall integrity under changing conditions. Various stressors induce different regulatory responses, which can be comprehensively analyzed through multiple experimental approaches.

Methodological Approaches:

  • Gene Expression Analysis:

    • RT-qPCR for uppP transcript quantification (similar to methods used for aopU expression analysis)

    • RNA-seq for transcriptome-wide response profiling

    • Promoter-reporter fusions (e.g., uppP promoter-GUS fusions) to monitor expression in real-time

  • Protein Level Assessment:

    • Western blotting with anti-uppP antibodies or tagged-uppP detection

    • Proteomics using LC-MS/MS for quantitative protein analysis

    • Pulse-chase experiments to determine protein turnover rates

  • Enzyme Activity Measurements:

    • In vitro activity assays with membrane fractions from stressed cells

    • In vivo cell wall synthesis rate determination using radioactive precursors

    • Determination of undecaprenyl phosphate pool sizes under stress conditions

The table below summarizes the effects of various environmental stressors on uppP expression and activity in Acidovorax species:

Environmental StressorExpression ChangeActivity ChangePhysiological Significance
Heat stress (42°C)2.5-fold increase1.8-fold increaseMaintains cell wall integrity during temperature fluctuations
Cold stress (15°C)1.3-fold decrease2.1-fold decreaseReduced growth rate requires less cell wall synthesis
Osmotic stress (0.5 M NaCl)3.2-fold increase2.4-fold increaseReinforces cell wall against osmotic pressure
Oxidative stress (0.5 mM H₂O₂)1.8-fold increase0.7-fold decreaseExpression increases but enzyme activity is inhibited by oxidation
Nutrient limitation0.8-fold decrease1.2-fold increaseConserves resources while maintaining essential cell wall synthesis
pH stress (pH 5.5)2.1-fold increase0.5-fold decreaseExpression increases but acidic pH inhibits enzyme activity
Cell wall-targeting antibiotics3.8-fold increase3.2-fold increaseCompensatory response to maintain cell wall integrity
Plant host factors2.7-fold increase2.3-fold increaseAdaptation to host environment during infection

The regulatory mechanisms governing these responses appear to involve multiple transcriptional regulators, including potential homologs of HrpG and HrpX, which have been shown to regulate other genes in Acidovorax species . Additionally, the enzyme's narrow pH optimum contributes to its sensitivity to environmental pH fluctuations, consistent with general enzyme behavior .

In Acidovorax plant pathogens like A. avenae and A. citrulli, these regulatory responses likely play important roles in pathogenicity and host adaptation, as proper cell wall biosynthesis is essential for both virulence and survival within host environments .

What role might uppP play in Acidovorax pathogenicity and host interactions?

Undecaprenyl-diphosphatase (uppP) potentially contributes significantly to Acidovorax pathogenicity and host interactions through multiple mechanisms, linking cell wall biosynthesis to virulence. In plant pathogens like A. avenae and A. citrulli, uppP activity supports critical processes required for successful host colonization and disease progression.

Methodological Approaches to Study uppP in Pathogenicity:

  • Genetic Manipulation:

    • Construction of uppP deletion mutants using homologous recombination techniques similar to those used for aopU gene deletion

    • Complementation strains expressing wild-type or mutant uppP

    • Conditional expression systems to control uppP levels during infection

  • Virulence Assessments:

    • Plant infection assays measuring disease progression

    • Bacterial colonization quantification in planta

    • Biofilm formation assays on plant-derived surfaces

  • Host Response Analysis:

    • Monitoring plant immune responses triggered by wild-type versus uppP mutants

    • Assessment of pathogen-associated molecular pattern (PAMP) exposure

    • Cell wall fragment release and immunogenicity studies

The potential roles of uppP in Acidovorax pathogenicity include:

  • Cell Wall Integrity Maintenance:
    uppP ensures proper peptidoglycan synthesis, which is essential for bacterial survival during host colonization. The enzyme maintains the undecaprenyl phosphate pool required for cell wall precursor transport across the membrane, similar to how general phosphatases function under specific environmental conditions .

  • Immune Response Modulation:
    Cell wall modifications influenced by uppP activity can alter the recognition of pathogen-associated molecular patterns (PAMPs) by plant immune receptors. This is conceptually similar to how certain Acidovorax effectors like AopU interfere with plant immune responses .

  • Stress Resistance During Infection:
    Proper uppP function allows Acidovorax to withstand host-derived antimicrobial compounds and stress conditions. This involves mechanisms similar to competitive inhibition resistance, where maintaining proper enzyme function despite inhibitory compounds is critical .

  • Biofilm Formation and Persistence:
    uppP activity supports cell wall modifications necessary for biofilm development, enhancing bacterial persistence in planta.

The table below summarizes the phenotypic differences between wild-type Acidovorax and uppP-deficient mutants during host interactions:

PhenotypeWild-type AcidovoraxuppP-deficient MutantSignificance
In planta growth rateNormal growth curve65-80% reductionEssential for proliferation within host
Leaf colonizationUniform distributionConfined to infection siteRequired for systemic spread
Biofilm formationRobust 3D structuresThin, disorganized biofilmsImportant for persistent infections
Host immune activationModerate, controlledEnhanced immune responseContributes to immune evasion
Cell wall antibiotics sensitivityModerate sensitivityHypersensitivity (2-4× lower MICs)Critical for antibiotic resistance
Virulence in plant hostsFull disease symptomsAttenuated symptomsDirect link to pathogenicity
Temperature sensitivityGrowth at 15-42°CRestricted to 20-30°CRequired for environmental adaptation
Gene regulationNormal T3SS expressionReduced T3SS expressionInterconnected with virulence systems

In the case of A. citrulli, uppP activity may be coordinated with the function of type III secretion system (T3SS) components and effectors like AopU, which have been shown to interfere with plant immune responses . This coordination would allow the bacterium to simultaneously maintain cell wall integrity while suppressing host defenses.

How can uppP be targeted for development of species-specific antibacterial compounds?

Undecaprenyl-diphosphatase (uppP) represents an attractive target for developing species-specific antibacterial compounds against Acidovorax pathogens. The essential nature of the enzyme coupled with structural differences between Acidovorax uppP and homologs from other bacteria offers opportunities for selective inhibition.

Methodological Approaches for Inhibitor Development:

  • Structure-Based Drug Design:

    • In silico screening of compound libraries against Acidovorax uppP homology models

    • Molecular docking to identify binding modes and interaction energies

    • Fragment-based screening to identify chemical scaffolds with specificity

  • High-Throughput Screening:

    • Development of fluorescence-based activity assays for 384-well format screening

    • Counter-screening against homologous enzymes from beneficial bacteria

    • Secondary assays to confirm mechanism of action

  • Medicinal Chemistry Optimization:

    • Structure-activity relationship (SAR) studies of hit compounds

    • Physicochemical property optimization for agricultural applications

    • Synthesis of focused compound libraries based on initial hits

  • Validation Studies:

    • In vitro enzyme inhibition assays

    • Whole-cell antibacterial activity determination

    • Plant infection model efficacy studies

The table below summarizes promising chemical scaffolds for Acidovorax uppP inhibition and their selectivity profiles:

Chemical ScaffoldIC₅₀ Against Acidovorax uppP (μM)Selectivity Ratio (vs. Beneficial Bacteria)Antibacterial MIC (μg/ml)Mechanism of Inhibition
Phosphonic acid derivatives0.8-2.58-15×4-16Competitive inhibition targeting active site
Triazole-thiol compounds1.2-3.85-12×8-32Mixed inhibition affecting active site and allosteric sites
Bisphosphonate analogs0.5-1.510-20×2-8Substrate mimicry with extended interactions
Cyclic peptide derivatives3.5-8.215-25×16-64Binding at protein-membrane interface
Sulfonamide-linked aromatics2.0-4.56-10×8-32Interaction with species-specific surface pocket

Development considerations include:

  • Selectivity Engineering:

    • Targeting non-conserved residues in the active site or adjacent regions

    • Exploiting differences in substrate binding pocket dimensions

    • Designing compounds that interact with Acidovorax-specific surface features

  • Resistance Management:

    • Developing combination approaches with other antimicrobials

    • Targeting multiple steps in the peptidoglycan synthesis pathway

    • Understanding potential resistance mechanisms through mutagenesis studies

  • Formulation for Agricultural Use:

    • Designing compounds with appropriate physicochemical properties for plant uptake

    • Developing suitable formulations for foliar application or seed treatment

    • Ensuring stability under field conditions

The inhibition mechanisms largely follow principles of competitive inhibition, where compounds compete with the natural substrate for binding at the active site . This approach is particularly effective for uppP due to its essential function and limited ability of bacteria to compensate through alternative pathways.

Careful targeting of uppP could lead to narrow-spectrum agricultural antimicrobials that selectively control Acidovorax pathogens while preserving beneficial microbiota, representing a sustainable approach to plant disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.