Recombinant Acidovorax sp. UPF0060 membrane protein Ajs_1473 (Ajs_1473)

What is Acidovorax sp. UPF0060 membrane protein Ajs_1473?

Acidovorax sp. UPF0060 membrane protein Ajs_1473 is a bacterial membrane protein consisting of 111 amino acids derived from Acidovorax species. It belongs to the UPF0060 protein family, which includes uncharacterized membrane proteins with conserved domains. The recombinant form typically includes a His-tag fusion to facilitate purification. The complete amino acid sequence is:
MELLKVAILFAVTAVAEIVGCYLPWLVVKQGKSAWLLLPAAVSLSLFAWLLTLHPTAAGRTYAAYGGMYIAVALVWLHVVDGVALTRWDFVGAAIALAGMSVIALQPATDT

What is known about the Acidovorax genus?

Acidovorax is a genus of beta-proteobacteria with diverse ecological roles. Members of this genus have been identified in various environments, including:

• Plant-associated strains that can be either plant growth-promoting or pathogenic

• Soil-dwelling strains capable of degrading polycyclic aromatic hydrocarbons (PAHs) like phenanthrene

• Strains involved in biocontrol applications against plant pathogens

Different Acidovorax species exhibit distinct functional traits, with some promoting plant growth through mechanisms involving organic acid sensing, phytohormone production, and antimicrobial compound production . Other species cause significant crop diseases, such as bacterial black spot in lamb's lettuce caused by Acidovorax valerianellae .

How is recombinant Ajs_1473 protein typically produced?

The recombinant Ajs_1473 protein is produced in E. coli expression systems. The full-length protein (amino acids 1-111) is typically fused to an N-terminal His-tag to facilitate purification . After expression, the protein is isolated and purified, then commonly supplied as a lyophilized powder. For quality control, purity is typically assessed using SDS-PAGE, with preparations typically exceeding 90% purity .

What are the recommended storage conditions for recombinant Ajs_1473?

The recombinant protein should be stored at -20°C to -80°C upon receipt. Lyophilized powder forms provide enhanced stability during storage. For working solutions:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

• Aliquot for long-term storage at -20°C to -80°C

Repeated freeze-thaw cycles should be avoided. Working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What methods are recommended for functional characterization of membrane proteins like Ajs_1473?

For functional characterization of Ajs_1473 and similar membrane proteins, researchers should consider:

• Structural analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Nuclear magnetic resonance (NMR) for small membrane proteins

  • X-ray crystallography if the protein can be crystallized

• Localization studies:

  • Immunofluorescence microscopy using anti-His antibodies

  • Cell fractionation followed by Western blotting

  • GFP fusion reporter systems

• Interaction analysis:

  • Pull-down assays exploiting the His-tag

  • Bacterial two-hybrid systems

  • Crosslinking studies with interaction partners

Similar approaches have been used in characterizing other Acidovorax proteins, such as those involved in phenanthrene degradation pathways in Acidovorax carolinensis .

How can researchers assess membrane integration of recombinant Ajs_1473?

The following methodological approaches are recommended:

• Membrane fractionation:

  • Separate bacterial membranes using ultracentrifugation

  • Analyze fractions by Western blotting with anti-His antibodies

  • Compare distribution between cytosolic, inner membrane, and outer membrane fractions

• Detergent solubility profile:

  • Test solubilization with different detergents (e.g., DDM, LDAO, OG)

  • Compare extraction efficiency using Western blotting

  • Optimize conditions for subsequent purification

• Protease protection assays:

  • Treat intact cells or membrane vesicles with proteases

  • Analyze fragmentation patterns to determine topology

  • Compare with predicted transmembrane domains

How might Ajs_1473 relate to the ecological functions of Acidovorax species?

While the specific function of Ajs_1473 remains uncharacterized, comparative genomic analyses of Acidovorax strains provide context for potential roles:

• Plant-microbe interactions:

  • Acidovorax species demonstrate diverse plant interactions, ranging from pathogenic to growth-promoting

  • Membrane proteins often function in sensing plant signals or facilitating attachment

  • Differential expression of membrane proteins correlates with plant interaction phenotypes

• Environmental adaptation:

  • Acidovorax strains isolated from PAH-contaminated soils possess specialized membrane proteins for xenobiotic sensing and transport

  • Membrane proteins like Ajs_1473 may function in environmental sensing or stress responses

• Bacterial communication:

  • Some Acidovorax species produce bacteriophages with lysogenic conversion potential

  • Membrane proteins can serve as receptors for bacteriophages or mediate competitive interactions

Analyzing the expression of Ajs_1473 under different environmental conditions or in different Acidovorax strains (pathogens versus growth-promoting) could provide insights into its functional role .

What approaches can be used to determine the structure-function relationship of Ajs_1473?

To elucidate structure-function relationships of Ajs_1473, researchers could employ:

• Computational analysis:

  • Predict transmembrane domains and topology using algorithms like TMHMM or Phobius

  • Identify conserved motifs through multiple sequence alignment with homologs

  • Model the 3D structure using tools like AlphaFold

• Site-directed mutagenesis:

  • Target conserved residues identified through bioinformatic analysis

  • Focus on charged residues within transmembrane domains

  • Assess functional changes using reporter assays

• Domain swapping:

  • Create chimeric proteins with related UPF0060 family members

  • Test function in heterologous expression systems

  • Map functional domains through systematic replacement

• In vivo functional complementation:

  • Generate knockout mutants in Acidovorax species

  • Complement with wild-type and mutant versions of Ajs_1473

  • Assess restoration of phenotypes related to membrane function

These approaches have been successfully applied to characterize other bacterial membrane proteins involved in environmental adaptation, such as those in Acidovorax strains that metabolize phenanthrene .

What is known about the genomic context of Ajs_1473 in Acidovorax species?

The genomic context of Ajs_1473 can provide important clues about its function:

• Operon structure:

  • Analysis of upstream and downstream genes may reveal functional relationships

  • Co-transcribed genes often participate in related cellular processes

  • Comparative genomics across Acidovorax species can identify conserved operonic structures

• Genomic islands:

  • Some Acidovorax functional traits are encoded within genomic islands

  • Determining whether Ajs_1473 is located within a genomic island could suggest horizontal acquisition

  • Pan-genome analysis of Acidovorax has revealed specific functional traits associated with ecological niches

• Regulatory elements:

  • Identification of promoter regions and transcription factor binding sites

  • Analysis of expression under different conditions using RT-PCR or RNA-seq

  • Correlation with expression of genes involved in specific functions (e.g., plant interaction, xenobiotic degradation)

Polyphasic characterization approaches similar to those used for Acidovorax carolinensis could be applied to understand the genomic context of Ajs_1473 .

What strategies can overcome challenges in solubilizing and purifying Ajs_1473?

Membrane proteins like Ajs_1473 present specific challenges in purification. Recommended approaches include:

• Optimized solubilization:

  • Screen detergents systematically (non-ionic, zwitterionic, and mild ionic)

  • Test different detergent:protein ratios (typically 10:1 to 100:1)

  • Consider detergent mixtures or amphipols for stability

• Purification optimization:

  • Utilize His-tag affinity chromatography under optimized conditions

  • Implement size exclusion chromatography to remove aggregates

  • Consider on-column detergent exchange during purification

• Stability enhancement:

  • Add glycerol (5-10%) to all buffers

  • Maintain physiologically relevant pH (typically 7.0-8.0)

  • Add specific lipids that may stabilize the native conformation

• Alternative expression strategies:

  • Test expression at lower temperatures (16-25°C)

  • Consider different E. coli strains (C41/C43 designed for membrane proteins)

  • Evaluate fusion partners beyond His-tag (MBP, SUMO) that may enhance solubility

How can researchers verify the correct folding of recombinant Ajs_1473?

Verifying proper folding of membrane proteins requires specialized approaches:

• Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate stability

  • Dynamic light scattering to assess monodispersity

• Functional assays:

  • Liposome reconstitution followed by functional tests

  • Proteoliposome-based assays if transport function is suspected

  • Binding studies with potential ligands

• Limited proteolysis:

  • Compare digestion patterns between native and denatured states

  • Well-folded membrane proteins show resistance to proteolysis

  • Map protected regions to predict structural domains

• Tryptophan fluorescence:

  • Analyze intrinsic fluorescence spectra

  • Compare with denatured controls

  • Assess environmental sensitivity of tryptophan residues

These approaches have been successfully applied to verify folding of other bacterial membrane proteins, including those involved in sensing and transport functions in environmental bacteria like Acidovorax .

How might Ajs_1473 relate to the pathogenic or beneficial traits of Acidovorax species?

Understanding Ajs_1473 could provide insights into Acidovorax ecological roles:

• Plant interaction mechanisms:

  • Acidovorax species display diverse plant interaction phenotypes

  • Membrane proteins often mediate recognition between bacteria and plant hosts

  • Comparative genomics has identified membrane proteins as key differentiators between pathogenic and beneficial Acidovorax strains

• Environmental adaptation:

  • Acidovorax strains from contaminated environments possess specialized membrane transporters

  • UPF0060 family proteins may contribute to stress tolerance or nutrient acquisition

  • Expression patterns under different conditions could reveal functional roles

• Potential biotechnology applications:

  • Acidovorax phages have been developed as biocontrol agents

  • Understanding membrane proteins could reveal phage receptors

  • Engineering membrane proteins might enhance beneficial traits for agricultural applications

Research comparing Ajs_1473 expression or mutation effects between pathogenic strains like A. valerianellae and beneficial strains could reveal functional contributions to these divergent lifestyles .

What are the potential research applications of recombinant Ajs_1473?

Researchers may utilize recombinant Ajs_1473 for:

• Structural biology:

  • Template for structural studies of UPF0060 family proteins

  • Comparison with homologs from other bacterial genera

  • Structure-guided design of inhibitors if related to pathogenicity

• Antibody development:

  • Generation of specific antibodies for tracking Acidovorax in environmental samples

  • Tools for studying Acidovorax colonization patterns in plants

  • Potential diagnostic applications for Acidovorax-associated plant diseases

• Functional genomics:

  • Protein-protein interaction studies to identify binding partners

  • Transcriptional regulation analysis in response to environmental stimuli

  • Comparative analysis across Acidovorax strains with different ecological roles

• Biotechnological applications:

  • Development of biosensors if involved in environmental sensing

  • Engineering for enhanced bioremediation capabilities

  • Target for biocontrol strategies against pathogenic Acidovorax strains

These applications align with broader research on Acidovorax species, which have demonstrated importance in both agricultural contexts and environmental remediation .