Recombinant Acidovorax sp. UPF0060 membrane protein Ajs_2087 (Ajs_2087)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Host and Expression System
The protein is heterologously expressed in E. coli, leveraging bacterial systems for scalable production. Key parameters include:

ParameterValue/Description
Expression HostE. coli
Tag OptimizationHis tag enables affinity chromatography for purification
Protein LengthFull-length (1–110 aa)

Biochemical Properties and Handling

Purity and Stability
The protein is purified to >90% homogeneity via SDS-PAGE analysis. Stability protocols include:

PropertySpecification
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0) ; Tris buffer with 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 5–50% glycerol
Storage Conditions-20°C/-80°C for long-term storage; avoid repeated freeze-thaw cycles

Research Applications

While specific functional studies are not detailed in available sources, Ajs_2087 is positioned for use in:

  1. Membrane Protein Studies: Investigating bacterial membrane architecture or transport mechanisms.

  2. Antibody Development: Served as an antigen in ELISA kits (e.g., CSB-CF379973AuC) for detecting Ajs_2087-specific antibodies .

  3. Protein-Protein Interactions: Potential applications in co-immunoprecipitation or pull-down assays, though no direct interaction data is provided .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ajs_2087; UPF0060 membrane protein Ajs_2087
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Acidovorax sp. (strain JS42)
Target Names
Ajs_2087
Target Protein Sequence
MLPFKTLALFLLTAVAEIVGCYLPWLWLRQGRSAWLLVPAAASLALFAWLLTLHPAATGR VYAAYGGVYVAVALVWLWTVDGVRPGPWDWLGVAVTLCGMAIIAFAPRGG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental systems are appropriate for studying Ajs_2087 function?

The appropriate experimental systems for studying Ajs_2087 function depend on the specific research questions being addressed. For in vitro studies, purified recombinant protein can be reconstituted in artificial membrane systems such as liposomes, nanodiscs, or detergent micelles to study its biophysical properties and potential interactions with other molecules. E. coli expression systems are the most commonly used for recombinant production, as evidenced by commercial preparations .

For in vivo studies, researchers should consider both homologous and heterologous expression systems. Studies on Acidovorax avenae subsp. avenae strain RS-1 have demonstrated the importance of comparing protein expression and function in different environmental contexts. The differential expression observed between in vitro culture conditions and in vivo plant environments suggests that contextual factors significantly influence protein behavior . This has critical implications for experimental design when studying membrane proteins like Ajs_2087.

Experimental SystemAdvantagesLimitationsBest For
E. coli expressionHigh yield, rapid growth, well-established protocolsMay lack proper folding for some proteinsInitial protein production, structural studies
Liposome reconstitutionControlled lipid environmentSimplified systemBiophysical characterization, transport studies
Native Acidovorax strainsNative expression contextMore challenging to manipulatePhysiological relevance studies
Plant infection modelsTrue in vivo contextComplex system with many variablesPathogenesis studies

How should Ajs_2087 be stored and handled to maintain stability?

Proper storage and handling of Ajs_2087 are crucial for maintaining protein stability and experimental reproducibility. According to product specifications, the lyophilized protein should be stored at -20°C or -80°C for extended storage periods . After reconstitution, working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

For reconstitution, the recommended protocol involves:

  • Brief centrifugation of the vial before opening to collect contents at the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) for aliquoting and long-term storage at -20°C/-80°C

The default final concentration of glycerol in commercial preparations is typically 50%, which serves as a cryoprotectant . For membrane proteins like Ajs_2087, it is often beneficial to add appropriate detergents during reconstitution to maintain the protein in a soluble state, as the hydrophobic transmembrane domains can cause aggregation in aqueous solutions.

What approaches are recommended for studying Ajs_2087 in membrane environments?

Studying membrane proteins like Ajs_2087 in their native environment presents unique challenges that require specialized methodologies. Several approaches have proven effective for investigating membrane protein structure and function:

Advanced structural biology techniques particularly suited for membrane proteins like Ajs_2087 include:

  • Cryo-electron microscopy (cryo-EM): Allows visualization of membrane proteins in native-like environments without crystallization

  • Solid-state NMR: Provides atomic-level structural information in membrane environments

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps protein dynamics and solvent accessibility

For functional characterization, researchers should consider electrophysiological methods to measure potential transport activities, fluorescence-based assays to monitor conformational changes, and isothermal titration calorimetry to quantify binding interactions with potential ligands or protein partners.

How does Ajs_2087 expression differ between in vitro and in vivo conditions?

Comparative proteomic studies of Acidovorax species have revealed significant differences in protein expression profiles between in vitro culture conditions and in vivo plant environments. These insights are highly relevant for Ajs_2087 research design. Shotgun proteomics analysis of outer membrane proteins from Acidovorax avenae subsp. avenae strain RS-1 identified 97 proteins expressed in vitro versus 62 proteins expressed in vivo .

Key differences observed in membrane protein expression include:

  • In vitro conditions predominantly expressed phospholipase and certain OmpA domain-containing proteins

  • In vivo conditions uniquely expressed surface anchored protein F, ATP-dependent Clp protease, and specific OmpA and MotB domain-containing proteins

These findings highlight the importance of environmental context in regulating membrane protein expression. For Ajs_2087 specifically, experimental design should account for potential regulation by host factors or environmental conditions. The UPF0060 family, to which Ajs_2087 belongs, may be subject to similar regulatory mechanisms, and researchers should consider both controlled laboratory conditions and physiologically relevant environments when studying this protein.

A comprehensive experimental approach would involve:

  • Comparison of Ajs_2087 expression levels in different growth media compositions

  • Analysis of expression during various growth phases

  • Examination of expression in response to environmental stressors

  • Assessment of expression during host-pathogen interactions if applicable

What are the challenges in structural analysis of Ajs_2087 and how can they be addressed?

Structural analysis of membrane proteins like Ajs_2087 presents several challenges due to their hydrophobic nature, conformational flexibility, and dependence on the membrane environment. The UPF0060 membrane protein family, to which Ajs_2087 belongs, has limited structural characterization in the literature, making it a particularly challenging target.

The primary challenges include:

  • Protein production: Membrane proteins often express poorly and may be toxic to host cells. For Ajs_2087, optimizing E. coli expression systems with tunable promoters and fusion tags beyond the standard His-tag may improve yields .

  • Protein purification: Extracting membrane proteins while maintaining their native fold requires careful detergent selection. A systematic detergent screening approach is recommended, starting with mild detergents like DDM and LMNG.

  • Conformational heterogeneity: Membrane proteins often exist in multiple conformational states. To address this, stabilizing mutations or ligands may be necessary to lock the protein in a specific conformation.

  • Crystallization difficulty: Traditional X-ray crystallography is challenging for membrane proteins. Alternative approaches include:

MethodAdvantagesResolution RangeSample Requirements
Cryo-EMNo crystallization needed2-4Å50-100μg protein
NMR SpectroscopyDynamic information3-5Å (size limited)Isotope-labeled protein
X-ray Free Electron LaserSmall crystals sufficient1.5-3ÅMicrocrystals
AlphaFold2 predictionNo experimental structure neededVariable accuracySequence only

For Ajs_2087 specifically, its relatively small size (110 amino acids) makes it potentially amenable to solution NMR approaches if it can be stabilized in detergent micelles or nanodiscs . Alternatively, a hybrid approach combining computational modeling with sparse experimental constraints from crosslinking mass spectrometry or EPR spectroscopy may provide valuable structural insights.

What is the potential role of Ajs_2087 in bacterial pathogenesis?

While the specific function of Ajs_2087 remains uncharacterized, insights from related Acidovorax species suggest potential roles in pathogenesis. Studies on Acidovorax avenae subsp. avenae strain RS-1, a rice pathogen, have demonstrated that outer membrane proteins play significant roles in bacterial pathogenesis . The differential expression of membrane proteins between in vitro and in vivo conditions highlights the importance of environmental context in regulating virulence-associated proteins.

Proteomic profiling of Acidovorax revealed that certain outer membrane proteins, including surface anchored protein F, ATP-dependent Clp protease, and specific OmpA and MotB domain-containing proteins, were preferentially expressed in vivo during plant infection . This suggests these proteins have roles in pathogenicity. While Ajs_2087 was not specifically mentioned in this list, as a membrane protein of the UPF0060 family, it may have related functions in membrane integrity, signaling, or host interaction.

Experimental approaches to investigate the potential role of Ajs_2087 in pathogenesis include:

  • Gene knockout studies: Creating Ajs_2087 deletion mutants to assess changes in virulence

  • Heterologous expression: Expressing Ajs_2087 in non-pathogenic bacteria to assess gain of function

  • Host response analysis: Investigating plant immune responses to purified Ajs_2087

  • Protein-protein interaction studies: Identifying host or bacterial proteins that interact with Ajs_2087

How can protein-protein interactions of Ajs_2087 be studied effectively?

Investigating protein-protein interactions (PPIs) of membrane proteins like Ajs_2087 requires specialized approaches that account for their hydrophobic nature and membrane environment. Several complementary methods are recommended:

  • Co-immunoprecipitation with membrane solubilization: This technique involves solubilizing membranes with mild detergents followed by immunoprecipitation using antibodies against Ajs_2087 or its His-tag. The major challenge is maintaining native interactions during solubilization.

  • Crosslinking mass spectrometry: Chemical crosslinkers can capture transient interactions, and subsequent mass spectrometry analysis can identify interaction partners. For membrane proteins like Ajs_2087, membrane-permeable crosslinkers are preferred.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect interactions in a cellular context.

  • Proximity labeling approaches: Methods like BioID or APEX2 fusions to Ajs_2087 can label proximal proteins in living cells, capturing both stable and transient interactions in the native membrane environment.

A systematic workflow for Ajs_2087 interaction studies might include:

StageMethodExpected OutcomeValidation Approach
Initial screeningPull-down with His-tagged Ajs_2087Candidate interactorsReverse pull-down
In situ verificationProximity labelingPhysiological interaction candidatesCo-localization studies
Direct interactionMicroscale thermophoresisBinding affinitiesMutagenesis of binding sites
Functional relevanceCo-expression/knockoutPhenotypic effectsComplementation studies

When analyzing results, it's important to distinguish between direct binding partners and proteins that are simply part of the same complex. For membrane proteins like Ajs_2087, consideration of the detergent or lipid environment is crucial as it can significantly affect interaction patterns.

What experimental approaches are recommended for functional annotation of Ajs_2087?

The functional annotation of uncharacterized proteins like Ajs_2087 (belonging to the UPF0060 family) requires a multi-faceted approach combining computational predictions with experimental validation. The fact that Ajs_2087 is a membrane protein with unknown function presents particular challenges that require specialized methodologies.

A comprehensive strategy for functional annotation should include:

  • Computational analysis and predictions:

    • Sequence-based comparisons with characterized proteins

    • Structural modeling (particularly using AlphaFold2 or RoseTTAFold)

    • Genomic context analysis (examining neighboring genes)

    • Identification of conserved domains or motifs

  • Expression pattern analysis:

    • Quantitative proteomics comparing expression under different conditions

    • Transcriptional analysis to identify co-regulated genes

    • Comparison of in vitro and in vivo expression as demonstrated in Acidovorax studies

  • Phenotypic characterization:

    • Generation of knockout or knockdown mutants

    • Complementation studies

    • Overexpression phenotypes

    • Growth under various stress conditions

  • Biochemical characterization:

    • Membrane topology mapping using reporter fusions

    • Post-translational modification analysis

    • Lipid interaction studies

    • Ion or small molecule transport assays

For Ajs_2087 specifically, the LC-MS/MS identification of related OmpA and MotB domain-containing proteins in Acidovorax suggests potential associations with Type VI secretion system components . This provides a valuable starting point for functional hypotheses, as membrane proteins with these domains often play roles in bacterial pathogenesis, membrane integrity, or transport functions.

How should experimental controls be designed when working with Ajs_2087?

Proper experimental controls are essential for rigorous research with Ajs_2087 and should address both the unique characteristics of membrane proteins and the specific features of recombinant protein work. A comprehensive control strategy should account for tag effects, expression system artifacts, and membrane environment variations.

For protein expression and purification experiments, the following controls are recommended:

  • Empty vector control: Cells transformed with expression vector lacking the Ajs_2087 gene, processed identically to the experimental samples.

  • Tag-only control: Expression of the His-tag alone or with a small fusion partner, to distinguish tag-mediated effects from protein-specific effects.

  • Denatured protein control: Heat-denatured Ajs_2087 preparation to distinguish specific activity from non-specific effects.

For functional assays, particularly those investigating membrane-associated properties:

Control TypePurposeImplementation
Negative controlEstablish baselineEmpty liposomes/membranes without Ajs_2087
Positive controlValidate assay functionalityWell-characterized membrane protein with known activity
Specificity controlConfirm target specificityAjs_2087 with point mutations in predicted functional regions
Environmental controlAccount for buffer/detergent effectsParallel experiments with varying detergents/lipids

The experimental design should incorporate principles from established frameworks as outlined in search result , particularly regarding the systematic manipulation of independent variables and measurement of dependent variables. For Ajs_2087, independent variables might include expression conditions, membrane composition, or environmental factors, while dependent variables could include protein folding status, membrane association, or specific biochemical activities.

How can researchers address data contradictions in Ajs_2087 studies?

Data contradictions in membrane protein research are common due to the sensitivity of these proteins to experimental conditions. For Ajs_2087 studies, a systematic approach to resolving contradictory results should include:

  • Methodological standardization: Carefully document and standardize protein preparation methods, detergent types and concentrations, buffer compositions, and storage conditions. Minor variations in these parameters can significantly impact membrane protein behavior and lead to apparently contradictory results.

  • Orthogonal validation: Employ multiple independent techniques to assess the same property. For example, protein-protein interactions should be validated by at least two different methods (e.g., co-immunoprecipitation and proximity labeling).

  • Systematic parameter variation: When contradictory results are observed, systematically vary experimental parameters to identify those that influence the outcome. This approach can transform contradictions into mechanistic insights about condition-dependent behavior.

  • Biological context consideration: As demonstrated in proteomic studies of Acidovorax, significant differences exist between in vitro and in vivo protein expression . Contradictory results may reflect genuine biological variation rather than experimental artifacts.

  • Meta-analysis approaches: For multiple contradictory studies, formal meta-analysis techniques can identify patterns and sources of heterogeneity. This includes:

    • Forest plots to visualize effect sizes across studies

    • Funnel plots to assess publication bias

    • Subgroup analyses based on methodological variations

When contradictions arise between computational predictions and experimental data for Ajs_2087, priority should generally be given to experimental evidence, but computational approaches can help generate hypotheses for targeted experimental validation.

What are the best practices for reproducibility in Ajs_2087 research?

Ensuring reproducibility in membrane protein research presents unique challenges due to the sensitivity of these proteins to experimental conditions. For Ajs_2087 studies, implementing the following best practices will enhance reproducibility:

  • Detailed methods reporting: Document complete protocols including:

    • Exact buffer compositions (including pH and ionic strength)

    • Detergent types, grades, and concentrations

    • Lipid compositions for reconstitution experiments

    • Expression strain genotypes

    • Purification conditions including temperature and flow rates

    • Storage conditions and duration before experiments

  • Quality control metrics: Implement and report standardized quality assessments:

    • Purity assessment by SDS-PAGE with specific staining methods

    • Mass spectrometry verification of protein identity

    • Circular dichroism to confirm secondary structure integrity

    • Size-exclusion chromatography profiles to assess aggregation state

  • Batch validation: For recombinant protein preparations:

    • Implement batch-to-batch comparison procedures

    • Maintain reference samples from validated batches

    • Document functional activity using standardized assays

  • Open data practices:

    • Deposit raw mass spectrometry data in public repositories

    • Share detailed protocols through platforms like protocols.io

    • Consider pre-registration of study designs for key experiments

  • Multivariate experimental design: Following principles outlined in search result , implement factorial designs to systematically assess the impact of multiple variables simultaneously rather than one-at-a-time approaches. This is particularly important for membrane proteins like Ajs_2087, where multiple factors interact to influence behavior.

When developing new assays or methods for Ajs_2087 characterization, formal validation studies should be conducted to establish reproducibility parameters including:

  • Intra-assay variability (repeatability)

  • Inter-assay variability (intermediate precision)

  • Inter-laboratory reproducibility when possible

What emerging technologies hold promise for Ajs_2087 research?

Several cutting-edge technologies are particularly promising for advancing our understanding of membrane proteins like Ajs_2087:

  • Cryo-electron tomography: This technique allows visualization of membrane proteins in their native cellular environment without isolation or purification. For Ajs_2087, this could reveal native organization and interactions within the bacterial membrane that are lost during conventional purification.

  • Single-molecule techniques: Methods such as single-molecule FRET or atomic force microscopy can capture conformational dynamics and rare states of membrane proteins that are averaged out in ensemble measurements.

  • Nanobody development: Developing nanobodies (single-domain antibody fragments) against Ajs_2087 could provide powerful tools for both structural stabilization and functional modulation. These have revolutionized structural studies of challenging membrane proteins.

  • Artificial intelligence approaches: Beyond AlphaFold2 structure prediction, emerging AI tools can predict protein-protein interactions, functional sites, and even design experiments to test specific hypotheses about Ajs_2087 function.

  • Microfluidic systems: These allow precise control of the membrane protein environment while minimizing sample consumption, enabling high-throughput screening of conditions or ligands that affect Ajs_2087 function.

  • In-cell NMR: This technique allows structural and dynamic studies of proteins within living cells, potentially bridging the gap between in vitro and in vivo observations that has been documented in Acidovorax membrane proteins .

The integration of computational approaches with these experimental technologies will be particularly valuable for generating and testing hypotheses about the function of uncharacterized proteins like Ajs_2087.

How can systems biology approaches contribute to understanding Ajs_2087 function?

Systems biology approaches offer powerful frameworks for contextualizing the function of uncharacterized proteins like Ajs_2087 within broader biological networks. These approaches are particularly valuable when direct functional assays are challenging or yield limited insights.

Key systems biology strategies for Ajs_2087 include:

  • Genetic interaction mapping: Systematic analysis of genetic interactions (synthetic lethality, suppression, or enhancement) between Ajs_2087 and other genes can place it within functional pathways. This can be implemented through Tn-seq approaches in Acidovorax or related organisms.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to identify correlations between Ajs_2087 expression and global cellular changes. The differential expression patterns observed between in vitro and in vivo conditions in Acidovorax provide a foundation for this approach .

  • Network analysis: Constructing protein-protein interaction networks, co-expression networks, or metabolic networks to identify patterns of association. For membrane proteins like Ajs_2087, specialized network construction approaches that account for membrane localization are recommended.

  • Comparative genomics: Analyzing the presence, absence, and genomic context of Ajs_2087 homologs across diverse bacterial species can reveal evolutionary patterns indicative of function. The UPF0060 family distribution may provide clues to functional specialization.

A systems-level understanding requires integration of diverse data types through computational frameworks:

Data TypeContribution to Functional UnderstandingIntegration Approach
TranscriptomicExpression patterns and co-regulationWeighted gene correlation network analysis
ProteomicProtein abundance and interactionsProtein-protein interaction networks
PhenomicGrowth or virulence phenotypesGenome-wide association studies
StructuralPotential binding sites or activitiesStructure-based functional annotation

The insights from systems biology approaches can guide targeted experimental validation and provide context for interpreting specific mechanistic studies of Ajs_2087.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.