Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Recombinant Acinetobacter baumannii ATP Synthase Subunit a (atpB): Overview

The Acinetobacter baumannii ATP synthase subunit a (atpB) is a critical component of the F<sub>O</sub>-ATP synthase complex, responsible for proton translocation and ATP synthesis. As part of the F<sub>O</sub> motor, it forms a proton channel in conjunction with the c-ring (c<sub>10</sub>) and interacts with the a-subunit to drive the proton motive force (pmf) essential for oxidative phosphorylation . Recombinant production of this subunit enables structural and functional studies, particularly in understanding its role in multidrug-resistant (MDR) A. baumannii strains, which rely heavily on ATP synthesis for survival and drug efflux pump activity .

Functional Role in ATP Synthase Activity

The a-subunit pairs with the c<sub>10</sub>-ring to form the proton channel, driving ATP synthesis via the binding change mechanism. Key findings include:

  • Proton Translocation: The a-subunit’s transmembrane helices (aH1–aH5) coordinate proton passage through conserved Asp and Glu residues .

  • Regulatory Adaptations: A. baumannii ATP synthase exhibits latent ATPase activity, regulated by the ε-subunit to prevent ATP waste. The a-subunit’s unique structure supports this regulation .

  • Drug Resistance: The a-subunit’s proton channel is linked to multidrug efflux pump function, making it a key target for combating antimicrobial resistance .

Therapeutic Potential and Drug Targeting

The a-subunit’s unique features make it a promising target for novel antimicrobials:

  • Loop Extension (aH4–aH5): The Lys206-containing loop, absent in human ATP synthases, could be exploited for species-specific inhibition .

  • Proton Channel Entry: Repositioned N-terminal α-helix offers a distinct binding site for inhibitors, avoiding off-target effects on host enzymes .

  • Heterologous Expression: Recombinant a-subunit production in E. coli or insect cells enables high-throughput screening of small-molecule inhibitors .

Challenges and Future Directions

  • Structural Complexity: The a-subunit’s large N-terminal insertion and c-ring dynamics complicate inhibitor design .

  • Resistance Mechanisms: Overexpression or mutations in the a-subunit may confer resistance to future therapies, necessitating combination approaches .

  • Functional Studies: Further mutagenesis of the a-subunit’s loop or proton channel residues is needed to elucidate its precise role in ATP synthesis regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
atpB; ACICU_00172; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Acinetobacter baumannii (strain ACICU)
Target Names
atpB
Target Protein Sequence
MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGFTAIHLDSMGWSIGLG VIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGKSRLIAPLALTIFVWIF LMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPSTDPNITLGMSLSVFVLILFYS IREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFLARPISLALRLFGNMYAGE LIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTIVYLSMASEKH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a critical role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of A. baumannii ATP synthase and where does subunit a (atpB) fit within this complex?

The ATP synthase from Acinetobacter baumannii has a subunit composition of α₃β₃γδεab₂c₁₀, similar to other bacterial F-type ATP synthases. The enzyme consists of two major functional domains: the membrane-embedded F₀ portion (containing subunits a, b₂, and c₁₀) and the catalytic F₁ portion (containing subunits α₃β₃γδε). Subunit a (atpB) is a critical component of the F₀ domain and forms part of the proton channel through the membrane, working in conjunction with the c-ring to couple proton translocation to ATP synthesis .

What unique structural features characterize the A. baumannii ATP synthase subunit a?

The a-subunit of A. baumannii ATP synthase contains several distinctive structural elements that differentiate it from homologs in other bacterial species:

  • Extended loop region: The a-subunit possesses an additional loop extension between helices aH4 and aH5, composed primarily of hydrophobic residues plus a charged lysine residue (²⁰⁰PSNPVAKALLIP²¹¹) .

  • Genus-specific conservation: This loop extension is conserved within the Acinetobacter genus and the Moraxellaceae family but is fully or partially absent in ATP synthases from other organisms .

  • Membrane proximity: Structural analysis indicates that this extended loop may reach the periplasmic membrane edge, potentially providing privileged access to small molecules and biologics that is absent in other species .

  • Potential lipid interaction: Lysine 206 appears to stretch toward the bilayer leaflet, suggesting it might interact with phospholipid headgroups .

These structural adaptations appear along both the entry and exit pathways of the proton-conducting a-subunit and represent unique features not present in mitochondrial ATP synthases, making them attractive targets for antimicrobial development .

How does the proton conduction pathway in A. baumannii ATP synthase subunit a differ from other bacterial homologs?

The proton conduction pathway in A. baumannii ATP synthase subunit a exhibits distinct structural adaptations compared to other bacterial homologs:

  • The a-subunit contains unique structural features along both the entry and exit pathways of the proton-conducting channel .

  • The identification of a distinct proton entrance within the A. baumannii a-subunit provides a potential avenue for designing specific inhibitors that could target bacterial ATP synthases without affecting those of the mammalian host .

  • The extended loop region between aH4 and aH5 in A. baumannii is substantially longer than in other bacteria, potentially affecting proton translocation mechanisms or providing novel interaction surfaces for inhibitor binding .

These differences in the proton conduction pathway represent significant adaptations that may contribute to the organism's energy metabolism and could serve as pathogen-specific targets for therapeutic intervention.

What expression systems are most effective for producing recombinant A. baumannii ATP synthase subunit a?

Based on research with similar membrane proteins and other A. baumannii proteins, the following expression systems have proven effective:

Bacterial Expression Systems:

  • E. coli-based expression: Research on other A. baumannii proteins (such as acid phosphatase AcpA) has successfully used E. coli for recombinant expression . For membrane proteins like subunit a, specialized E. coli strains such as C41(DE3) or C43(DE3) may provide better yields.

Expression Vector Considerations:

  • Vectors containing T7 promoters have been used successfully for other A. baumannii proteins

  • Addition of affinity tags (particularly His₆-tags) facilitates purification while maintaining protein function

  • Inclusion of fusion partners (such as maltose-binding protein) may improve folding and solubility

Induction Parameters:

  • Lower temperatures (16-20°C) during induction

  • Reduced IPTG concentrations (0.1-0.5 mM)

  • Extended induction periods (16-24 hours)

For successful expression of membrane proteins like subunit a, it's critical to balance protein production with the cell's capacity for proper membrane insertion and folding.

What purification strategies yield functional A. baumannii ATP synthase subunit a protein?

Purification of membrane proteins like ATP synthase subunit a requires specialized approaches:

Membrane Preparation:

  • Cell lysis via mechanical disruption (French press or sonication)

  • Differential centrifugation to isolate membrane fractions

  • Membrane solubilization using detergents

Detergent Selection:

  • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin preserve ATP synthase structure and function

  • The entire ATP synthase complex from A. baumannii has been successfully purified and reconstituted into peptidiscs for structural analysis

Affinity Chromatography:

  • Nickel-affinity purification for His-tagged constructs

  • Ion exchange chromatography as a secondary purification step

Functional Verification:

  • ATPase activity assays can be conducted to verify functional state

  • Similar to the approach used with A. baumannii F₁-ATPase, which displayed approximately 0.2 ± 0.001 μmol·min⁻¹ (mg of protein)⁻¹ ATP hydrolysis activity in its wild-type form

What structural analysis techniques have been most informative for studying A. baumannii ATP synthase components?

Several structural analysis techniques have provided valuable insights into A. baumannii ATP synthase:

Cryo-Electron Microscopy (Cryo-EM):

  • Cryo-EM has been successfully employed to resolve the structure of A. baumannii F₁F₀-ATP synthase in three distinct conformational states at resolutions of 3.1, 4.6, and 4.3 Å respectively

  • Masked refinements improved local resolution in the F₀ region from 4-7 Å to 3.7 Å

  • This technique revealed the 120° rotation states of the central stalk and allowed visualization of unique structural features in the a-subunit

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • NMR has been used to determine the solution structure of the epsilon subunit of A. baumannii F₁-ATPase

  • This technique provided atomic-level insights into the conformational states relevant to ATP hydrolysis inhibition and ATP synthesis

Biochemical Analyses:

  • ATP hydrolysis activity assays have been used to assess functional properties of purified A. baumannii ATP synthase components

  • The recombinant variant AbF₁-αβγεΔ134–139 showed an ATP hydrolysis activity of 5.3 ± 0.03 μmol·min⁻¹ (mg of protein)⁻¹, approximately 26 times higher than the latent wild-type enzyme

How does the A. baumannii ATP synthase regulate the balance between ATP synthesis and hydrolysis?

A. baumannii ATP synthase employs sophisticated regulatory mechanisms to maintain ATP:ADP homeostasis:

  • Inhibitory ε subunit regulation:

    • The C-terminal domain of subunit ε undergoes translocation and structural transformation to regulate ATP hydrolysis and favorable ATP synthesis

    • This regulation prevents wasteful ATP consumption while allowing efficient ATP synthesis when proton motive force is present

  • Self-inhibition mechanism:

    • The nucleotide-converting F₁ subcomplex reveals a specific self-inhibition mechanism that supports a unidirectional ratchet mechanism to avoid wasteful ATP consumption

    • This mechanism appears to be critical for the organism's energy conservation

  • Conformational states:

    • Recent cryo-EM studies have revealed multiple distinct conformational states of the enzyme, with the central stalk rotated by almost exactly 120° between each state

    • These states represent stable low-energy intermediate states in the catalytic cycle

  • Role of specific residues:

    • The C-terminal residues 134IKNRAQ139 of subunit ε are particularly important in ATP hydrolysis autoinhibition

    • Deletion of these residues in the Δ134–139 mutant results in significantly increased ATP hydrolysis activity compared to the wild-type enzyme

What is the significance of the unique loop extension in A. baumannii ATP synthase subunit a for antimicrobial development?

The extended loop region in A. baumannii ATP synthase subunit a presents several characteristics that make it an attractive target for antimicrobial development:

  • Pathogen specificity: The loop extension is conserved specifically within the Acinetobacter genus and Moraxellaceae family but is absent in other bacterial ATP synthases and mammalian homologs, offering a means to develop highly selective inhibitors .

  • Surface accessibility: The loop appears to reach the periplasmic membrane edge, potentially providing privileged access to small molecules and biologics, which is absent in other species .

  • Functional significance: The a-subunit is crucial for proton translocation and ATP synthesis, making it an essential target for bacterial viability.

  • Structural uniqueness: The hydrophobic composition with a charged lysine residue (²⁰⁰PSNPVAKALLIP²¹¹) presents a distinctive chemical environment for specific binding interactions .

  • Potential membrane interaction: Lysine 206 appears to stretch toward the bilayer leaflet, suggesting that it might interact with phospholipid headgroups, providing another potential mechanism for disruption .

Given that A. baumannii is classified as a priority 1 critical pathogen by the WHO and is known for multidrug resistance, targeting these unique structural features could lead to new therapeutic approaches that overcome existing resistance mechanisms.

What are the challenges and solutions for reconstituting functional A. baumannii ATP synthase in artificial membrane systems?

Reconstituting functional A. baumannii ATP synthase presents several challenges and potential solutions:

Challenges:

  • Membrane protein stability: The hydrophobic nature of subunit a and other membrane components makes them prone to aggregation and denaturation during purification.

  • Functional reconstitution: Maintaining the integrity of the proton channel and ensuring proper orientation in artificial membranes.

  • Functional assessment: Measuring ATP synthesis activity in reconstituted systems requires generation of a proton gradient.

Solutions and Methodologies:

ChallengeMethodological ApproachApplication to A. baumannii ATP Synthase
Protein stabilityPeptidisc reconstitutionSuccessfully used for structural studies of A. baumannii ATP synthase complex
Detergent selectionScreening mild detergents (DDM, digitonin)These preserve ATP synthase structure and activity
Membrane mimeticsNanodiscs, liposomes, amphipolsAllow functional studies in near-native environment
Functional assessmentProton gradient generation via pH jump or light-driven pumpsCan be used to drive ATP synthesis in reconstituted systems
Orientation controlpH-dependent reconstitution protocolsEnsures uniform orientation for accurate activity measurement

The successful reconstitution of A. baumannii ATP synthase into peptidiscs for cryo-EM analysis demonstrates that functional reconstitution is feasible with appropriate methodology.

How can researchers target the unique structural features of A. baumannii ATP synthase subunit a for inhibitor development?

Targeting the unique structural features of A. baumannii ATP synthase subunit a requires specialized approaches:

Structure-Based Design Strategies:

  • Loop-targeting molecules: Develop compounds that specifically bind to the unique loop extension between aH4 and aH5 (²⁰⁰PSNPVAKALLIP²¹¹) .

  • Proton pathway inhibitors: Design molecules that block the distinct entrance pathway identified in the a-subunit, interfering with proton translocation .

  • Interface disruptors: Create compounds that disturb the critical interface between subunit a and the c-ring.

Experimental Approaches:

  • Molecular docking: Utilize the cryo-EM structure of A. baumannii ATP synthase to screen virtual libraries for potential inhibitors.

  • Fragment-based screening: Identify chemical scaffolds that bind to critical regions of subunit a.

  • Peptide mimetics: Design peptides that mimic the loop extension to interfere with its natural function.

Specificity Considerations:

  • Exploit structural differences: Focus on features absent in human mitochondrial ATP synthase to ensure selectivity.

  • Genus-specific conservation: Target regions conserved within Acinetobacter but distinct from other bacteria to develop narrow-spectrum agents .

  • Membrane accessibility: Leverage the apparent membrane proximity of the loop extension, which may provide privileged access to compounds .

These approaches take advantage of the detailed structural information now available for A. baumannii ATP synthase and could lead to novel antimicrobials against this priority pathogen.

What are the current methodologies for studying the conformational dynamics of ATP synthase subunit a during the catalytic cycle?

Understanding the conformational dynamics of ATP synthase subunit a during catalysis requires sophisticated methodological approaches:

Time-Resolved Structural Techniques:

  • Time-resolved cryo-EM: Captures intermediates in the catalytic cycle by rapidly freezing samples at different time points after initiating ATP synthesis or hydrolysis.

  • Single-molecule FRET: Allows real-time monitoring of distance changes between strategically placed fluorophores in the protein structure.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions with changing solvent accessibility during the catalytic cycle.

Computational Approaches:

  • Molecular dynamics simulations: Using the cryo-EM structures of A. baumannii ATP synthase in different states as starting points for simulating conformational transitions.

  • Normal mode analysis: Identifying intrinsic motions that may be important for function.

  • Markov state modeling: Predicting intermediate states and transition pathways between the observed conformational states.

Functional Correlation Studies:

  • Site-directed spin labeling and EPR spectroscopy: Monitoring the mobility and environment of specific residues during catalysis.

  • Structure-guided mutagenesis: Creating variants with altered dynamics based on the observed conformational states .

  • Single-molecule rotation assays: Directly observing the rotation of the central stalk and correlating it with conformational changes in subunit a.

The observation of three distinct conformational states in A. baumannii ATP synthase by cryo-EM , with the central stalk rotated by 120° between states, provides a foundation for understanding the conformational dynamics of this complex molecular machine.

How can insights from A. baumannii ATP synthase structure contribute to developing solutions for antimicrobial resistance?

The structural and functional understanding of A. baumannii ATP synthase offers several avenues for addressing antimicrobial resistance:

  • Novel drug target validation: As a priority 1 critical WHO pathogen, A. baumannii urgently requires new therapeutic approaches. The ATP synthase represents an essential and largely unexploited target .

  • Pathogen-specific inhibitors: The unique structural adaptations in the a-subunit, particularly the loop extension between aH4 and aH5, provide opportunities for developing highly selective inhibitors that target A. baumannii without affecting human ATP synthases .

  • Combination therapy approaches: ATP synthase inhibitors could potentially synergize with existing antibiotics by compromising energy production in resistant strains.

  • Resistance mechanism insights: Understanding how mutations in ATP synthase components affect inhibitor binding could help predict and prevent resistance development.

  • Cross-species comparative analysis: The specific features identified in A. baumannii ATP synthase can inform broader approaches to targeting this enzyme family in other multidrug-resistant pathogens.

The identification of structural features absent in mitochondrial ATP synthases represents particularly attractive targets for developing next-generation therapeutics that can act directly at the culmination of bioenergetics in this clinically relevant pathogen .

What are the current limitations in our understanding of A. baumannii ATP synthase subunit a and how might they be addressed?

Despite significant advances, several knowledge gaps remain in our understanding of A. baumannii ATP synthase subunit a:

Knowledge GapCurrent LimitationProposed Research Approach
Proton translocation mechanismIncomplete understanding of the exact pathway and key residuesSite-directed mutagenesis coupled with functional assays
Conformational dynamicsLimited information about real-time structural changesSingle-molecule techniques and time-resolved structural studies
Interaction with other subunitsInsufficient detail about interface residues crucial for functionCross-linking mass spectrometry and interface mapping
Species-specific inhibitionFew validated inhibitors targeting subunit a specificallyStructure-based drug design focusing on unique structural features
In vivo regulationLimited understanding of how ATP synthase activity is regulated in living bacteriaSystems biology approaches and in vivo imaging

Addressing these limitations will require integrative approaches combining structural biology, biochemistry, computational modeling, and microbiology. The recent advances in cryo-EM technology that enabled the structural determination of A. baumannii ATP synthase in three conformational states provide a strong foundation for these future studies.

How do environmental factors affect the expression and function of ATP synthase in A. baumannii?

A. baumannii must adapt to various environmental conditions during infection and colonization, which likely influences ATP synthase expression and function:

  • Oxygen availability: As a strictly aerobic organism, A. baumannii depends on oxidative phosphorylation catalyzed by its F-ATP synthase . Different oxygen levels may affect ATP synthase expression levels and activity.

  • pH adaptation: The proton-conducting function of ATP synthase may be affected by environmental pH. The ATP synthase may play a role in pH homeostasis under acidic conditions encountered during infection.

  • Nutrient availability: Changes in carbon source availability may affect the expression and regulation of ATP synthase components as part of metabolic adaptation.

  • Antibiotic exposure: Sub-inhibitory concentrations of antibiotics might trigger compensatory changes in ATP synthase expression or activity to maintain energy homeostasis.

  • Biofilm formation: The transition between planktonic and biofilm growth states likely involves changes in energy metabolism and potentially ATP synthase regulation.

  • Host immune factors: Exposure to host defensive factors may trigger adaptive responses that include modulation of ATP synthase activity.

Understanding these environmental influences on ATP synthase function could provide insights into A. baumannii pathogenesis and potential vulnerabilities that could be targeted therapeutically.

What are the most promising research directions for studying A. baumannii ATP synthase subunit a in the next five years?

Based on current findings and technological advances, several research directions show particular promise:

  • Structure-based drug design: Using the recently solved structures of A. baumannii ATP synthase to develop selective inhibitors targeting the unique features of subunit a.

  • Conformational dynamics: Applying emerging time-resolved structural techniques to understand the dynamic behavior of subunit a during the catalytic cycle.

  • Genetic approaches: Implementing CRISPR-based methods to create and study the effects of specific mutations in subunit a in the native organism.

  • In vivo studies: Developing tools to study ATP synthase function within living A. baumannii cells during infection and under various stress conditions.

  • Combination therapy development: Exploring how ATP synthase inhibitors might synergize with existing antibiotics to overcome resistance mechanisms.

  • Comparative analysis: Extending structural and functional studies to ATP synthases from other ESKAPE pathogens to identify common principles and unique features.

These research directions leverage the recent structural advances while addressing the critical need for new therapeutic approaches against this priority pathogen.

How might synthetic biology approaches be applied to engineer modified versions of A. baumannii ATP synthase for research and therapeutic applications?

Synthetic biology offers innovative approaches to studying and targeting A. baumannii ATP synthase:

Research Applications:

  • Reporter systems: Engineering ATP synthase subunits fused with fluorescent proteins to monitor expression, localization, and assembly in live cells.

  • Controllable expression: Creating inducible systems to modulate ATP synthase levels and study the consequences for bacterial physiology.

  • Chimeric proteins: Generating hybrid ATP synthases with subunits from different species to identify functionally critical regions.

  • Minimal ATP synthase: Designing simplified versions to understand the core functional requirements.

Therapeutic Applications:

  • Engineered susceptibility: Creating A. baumannii strains with modified ATP synthases that are hypersensitive to specific inhibitors for use in drug screening.

  • Antimicrobial delivery: Developing peptides or proteins that specifically recognize unique features of the A. baumannii a-subunit to deliver antimicrobial cargo.

  • Competitive inhibition: Engineering decoy proteins that mimic ATP synthase components to disrupt assembly or function.

  • Diagnostic tools: Using engineered ATP synthase components as specific recognition elements in diagnostic platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.