Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized in E. coli using standard methods:

StepDetailsSource
CloningPCR-amplified nuoK gene cloned into expression vectors (e.g., pGEM-T)
ExpressionInduced in E. coli using IPTG or similar inducers
PurificationAffinity chromatography (His-tag binding to Ni/Co columns)
Quality ControlSDS-PAGE, Western blotting, and mass spectrometry for sequence validation

Research Applications and Potential Uses

While direct studies on A. baumannii nuoK are sparse, its availability supports:

  • Structural Biology: Crystallization and X-ray diffraction studies to resolve β-barrel architecture.

  • Antibiotic Targeting: Exploring vulnerabilities in NDH-1 for novel antimicrobial strategies.

  • Vaccine Development: Investigating subunit vaccines, though current focus remains on outer membrane proteins (e.g., OmpA) .

Comparative Analysis with Homologs

Recombinant nuoK variants from other species highlight conserved and divergent features:

SpeciesUniProt IDLength (aa)Key DifferencesSource
A. baumanniiB7I7481–102Full-length, His-tagged
Anaeromyxobacter dehalogenansQ2IHA41–99Partial sequence, distinct β-barrel features
Acidithiobacillus ferrooxidansNot reported in provided sources

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; A1S_0761; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Target Names
nuoK
Target Protein Sequence
MGQIPLEHGLIVATILFALGFYGVMVRRNLLFMLMSLEIMMNAAALAFVLAGSVWAQPDG QVMFILILTLAAAEACIGLAIVLQFYHRFHHLDVDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. It couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thus conserving redox energy in a proton gradient.
Database Links

KEGG: acb:A1S_0761

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying NADH-quinone oxidoreductase subunit K (nuoK) in Acinetobacter baumannii?

NADH-quinone oxidoreductase (complex I) plays a critical role in the respiratory chain of many organisms, including A. baumannii. This enzyme catalyzes the transfer of electrons from NADH to quinones and serves as an entry point to the electron transport chain . Specifically, nuoK is one of the membrane subunits that contributes to the structure and function of this complex enzyme.

Studying nuoK in A. baumannii is significant for several reasons:

  • It provides insights into the respiratory metabolism of this pathogen, which could reveal potential drug targets

  • A. baumannii is a multidrug-resistant opportunistic pathogen associated with hospital-acquired infections, classified as a top priority pathogen by WHO

  • Understanding the structure and function of respiratory components may help explain the remarkable environmental persistence of this organism in healthcare settings

  • The enzyme complex is essential for energy production, making it potentially critical for bacterial survival during infection

What are the recommended expression systems for recombinant production of A. baumannii nuoK?

For recombinant production of A. baumannii nuoK, the following expression systems are recommended:

E. coli-based expression:

  • BL-21(DE3) strain has been successfully used for expressing membrane proteins from A. baumannii

  • pET expression vectors (such as pET-28a) containing the T7 promoter system offer high-level expression with N-terminal His-tags for purification

  • Induction with IPTG (0.4 mmol/L) at 37°C for 4 hours has been shown to be optimal for maximum protein yield

A. baumannii expression:

  • Shuttle plasmids derived from pWH1277 and RSF1010 can be used for expression within A. baumannii itself

  • For inducible expression in A. baumannii, plasmids with arabinose-inducible (PBAD) or IPTG-inducible (PTAC) promoters are available

  • Inclusion of epitope tags (such as Flag-tag) facilitates protein detection and purification

The choice between these systems depends on research objectives:

  • E. coli systems typically yield higher protein quantities but may not provide native post-translational modifications

  • A. baumannii expression may better reflect native protein folding and interactions but generally provides lower yields

What purification strategies are most effective for recombinant A. baumannii nuoK?

Purification of membrane proteins like nuoK requires specific approaches:

Affinity chromatography:

  • Nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography is highly effective for His-tagged nuoK

  • Typical protocol:

    • Lyse cells in buffer containing 50 mM Tris pH 8.0, 150 mM NaCl with appropriate detergents

    • Load clarified lysate onto equilibrated Ni-NTA column

    • Wash with buffer containing 30 mM imidazole to remove non-specific binding

    • Elute protein with buffer containing 300 mM imidazole

    • Perform dialysis to remove imidazole

Detergent considerations:

  • Membrane proteins require careful detergent selection for extraction and stabilization

  • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are often effective

  • Detergent concentration is critical: too low fails to extract the protein, too high can denature it

Quality assessment:

  • SDS-PAGE with Coomassie blue staining to assess purity

  • Western blotting using anti-His antibodies to confirm identity

  • Size exclusion chromatography to evaluate oligomeric state

  • Yields of 1-3 mg/mL purified protein should be achievable based on similar A. baumannii proteins

What genetic tools are available for manipulating the nuoK gene in A. baumannii?

Several genetic tools have been developed for manipulating genes in A. baumannii, which can be applied to nuoK studies:

Homologous recombination approaches:

  • Two-step homologous recombination using suicide plasmids carrying antibiotic resistance markers flanked by homologous regions adjacent to the target gene

  • Single-step scarless deletion methods using RecET recombinase system

  • Utilization of the native DNA uptake capability of A. baumannii for direct transformation of linear DNA fragments

CRISPR-based systems:

  • Modified CRISPR-Cas9 systems adapted for A. baumannii have been developed

  • The system requires components for Cas9 nuclease expression and sgRNA targeting nuoK

  • Enhanced recombination efficiency can be achieved using RecAb from A. baumannii IS-123 strain

Complementation systems:

  • miniTn7 system allows site-specific integration at a neutral genomic position upstream of the glmS2 gene

  • Plasmid-based systems using pVRL1 or IncQ group plasmids (like pJL01-04) with inducible promoters enable controlled expression

Efficiency varies between laboratory strains (e.g., ATCC 17978, ATCC 19606) and clinical isolates, with the latter often requiring adaptations due to higher antibiotic resistance profiles .

How does the structure of nuoK contribute to the function of NADH-quinone oxidoreductase in A. baumannii, and what approaches can be used to study this relationship?

NuoK is a hydrophobic subunit of NADH-quinone oxidoreductase (complex I) located in the membrane domain. While no A. baumannii-specific structural data is directly available, comparative analysis with other bacterial species suggests:

Structural features and significance:

  • NuoK is likely a small (~100 amino acids), highly hydrophobic protein with multiple transmembrane helices

  • It contributes to the formation of the proton translocation pathway in the membrane domain

  • It may interact with neighboring subunits (likely NuoA, NuoH, NuoJ, NuoL, NuoM, NuoN) to form the complete membrane arm of complex I

Methodological approaches for structure-function studies:

  • Cysteine scanning mutagenesis:

    • Systematically replace residues with cysteine

    • Apply membrane-impermeable thiol-reactive reagents to identify exposed residues

    • This approach can map transmembrane topology and identify functionally important sites

  • Site-directed mutagenesis of conserved residues:

    • Identify highly conserved residues across species

    • Generate point mutations using recombination techniques

    • Assess functional impact through complementation of nuoK deletion strains

    • Recommended mutation strategy: use the two-step homologous recombination approach with a knockout cassette design using PCR or Gibson assembly

  • Protein-protein interaction studies:

    • Chemical cross-linking followed by mass spectrometry to identify interacting partners

    • Blue native gel electrophoresis to assess complex assembly

    • Co-immunoprecipitation using tagged nuoK to pull down interacting subunits

    • Methods similar to those used for AamA interaction studies could be applied

  • Structural analysis:

    • Cryo-electron microscopy of purified complex I

    • Small-angle X-ray scattering (SAXS) to examine solution structure

    • Molecular dynamics simulations based on homology models

What is the role of nuoK in A. baumannii pathogenesis and antibiotic resistance, and how can this be experimentally determined?

While the direct role of nuoK in pathogenesis has not been specifically documented, respiratory chain components may significantly impact A. baumannii virulence and resistance:

Potential roles:

  • Energy production for survival during infection

  • Contribution to membrane potential, which affects antibiotic efflux

  • Involvement in redox balance and oxidative stress resistance

  • Potential contribution to persistence under antibiotic pressure

Experimental approaches to elucidate these roles:

  • Infection models:

    • Generate nuoK deletion mutants using homologous recombination

    • Test virulence in mouse bacteremia models as described for other A. baumannii genes

    • Evaluate survival in human serum or macrophage co-culture systems

    • Measure bacterial persistence in various infection sites (lungs, blood, wounds)

  • Antibiotic susceptibility testing:

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type vs. nuoK mutants

    • Assess the effect of efflux pump inhibitors on antibiotic susceptibility

    • Measure membrane potential using fluorescent dyes in wild-type vs. mutant strains

    • Test survival under antibiotic challenge in biofilm conditions

  • Transcriptomic/proteomic analyses:

    • RNA-seq comparing global gene expression patterns between wild-type and nuoK mutants

    • Proteomics to identify compensatory changes in membrane protein expression

    • Metabolomics to detect alterations in redox balance and energy metabolism

  • Fitness studies:

    • Utilize transposon insertion sequencing (TraDIS) to assess fitness contribution of nuoK in different conditions

    • Competitive growth assays between wild-type and nuoK mutant strains

    • Assess persistence under nutrient limitation or oxidative stress

How can researchers address the challenges of heterologous expression and proper folding of recombinant A. baumannii nuoK?

Membrane proteins like nuoK present significant challenges for recombinant expression and proper folding. Advanced strategies to overcome these challenges include:

Optimization of expression conditions:

  • Expression strain selection:

    • C41(DE3) or C43(DE3) E. coli strains (derivatives of BL21) designed for membrane protein expression

    • Lemo21(DE3) strain allowing tunable expression through T7 lysozyme regulation

    • A. baumannii expression systems for native-like membrane environment

  • Expression protocol refinement:

    • Lower temperature expression (16-25°C) to slow protein synthesis and improve folding

    • Reduced inducer concentration for slower expression rate

    • Addition of chemical chaperones like glycerol (5-10%) or specific lipids

    • Co-expression with molecular chaperones

  • Fusion tags beyond standard His-tags:

    • MBP (maltose-binding protein) fusion to enhance solubility

    • SUMO fusion for improved folding and potential cleavage

    • Mistic or YidC fusions to target membrane insertion

    • GFP fusion to monitor folding and membrane integration in real-time

Protein extraction and stabilization:

  • Detergent screening:

    • Systematic testing of detergent types (DDM, LMNG, GDN, etc.)

    • Detergent concentration optimization for each preparation step

    • Use of detergent mixtures or amphipols for stabilization

  • Lipid supplementation:

    • Addition of specific lipids from A. baumannii membranes

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Bicelle formation for structural studies

  • Activity preservation assessment:

    • Development of activity assays specific for nuoK function

    • Membrane potential measurements using fluorescent probes

    • Electron transfer measurements in reconstituted systems

What approaches can be used to study the electron transfer mechanism involving nuoK in the NADH-quinone oxidoreductase complex of A. baumannii?

The electron transfer mechanism in NADH-quinone oxidoreductase is complex, involving multiple subunits and cofactors. For studying nuoK's role in this process:

Biochemical and biophysical techniques:

  • Spectroscopic methods:

    • UV-visible spectroscopy to monitor redox changes in FAD and iron-sulfur clusters

    • EPR (electron paramagnetic resonance) to detect paramagnetic centers and their redox states

    • FTIR (Fourier-transform infrared) spectroscopy to examine proton translocation events

    • Resonance Raman spectroscopy for studying iron-sulfur cluster environments

  • Kinetic measurements:

    • Steady-state kinetics with varied substrates (NADH, quinone analogs)

    • Pre-steady-state kinetics using stopped-flow or rapid freeze-quench techniques

    • Measurement of proton translocation coupled to electron transfer

    • Determining the effects of inhibitors like piericidin A (Ki ≈ 45 nM for bacterial complex I)

Structural and computational approaches:

  • Site-directed mutagenesis of key residues:

    • Identification of conserved charged residues potentially involved in proton pathways

    • Systematic mutation of these residues followed by functional assessment

    • Electrophysiological measurements in reconstituted systems

  • Computational modeling:

    • Molecular dynamics simulations of proton and electron transfer

    • Quantum mechanical/molecular mechanical (QM/MM) calculations

    • Analysis of proton pathways through the membrane domain

Relevant parameters from related systems that can guide A. baumannii studies:

ParameterValueReference System
Km for NADH5.0 μMBacterial NDH-1
Km for ubiquinone-22.0 μMBacterial NDH-1
Km for decylubiquinone10 μMBacterial NDH-1
Ki for piericidin A45 nMBacterial NDH-1

How can recombinant A. baumannii nuoK be leveraged for drug discovery targeting multidrug-resistant strains?

Given the critical importance of respiration for bacterial viability and the absence of complex I in mammals, nuoK and the NADH-quinone oxidoreductase complex represent potential targets for new antimicrobials against multidrug-resistant A. baumannii:

Target validation approaches:

  • Essentiality assessment:

    • Conditional knockout systems to determine if nuoK is essential

    • TraDIS or similar methods to quantify fitness contribution under various conditions

    • Validation in clinically relevant infection models

  • Druggability assessment:

    • Structural analysis to identify potential binding pockets

    • Fragment-based screening against purified complex I

    • In silico docking to identify potential binding sites

Drug discovery methodologies:

  • High-throughput screening platforms:

    • Development of whole-cell phenotypic screens targeting respiratory function

    • Biochemical assays using purified complex I to measure NADH oxidation or quinone reduction

    • Binding assays using labeled ligands and purified nuoK or complex I

    • Thermal shift assays to identify stabilizing compounds

  • Rational design strategies:

    • Structure-based design of inhibitors targeting the quinone binding site

    • Peptidomimetics targeting protein-protein interfaces involving nuoK

    • Modification of known respiratory inhibitors for increased specificity

  • Validation of hits:

    • Testing against diverse clinical isolates of A. baumannii

    • Assessment of resistance development frequency

    • Evaluation of specificity against mammalian complex I

    • In vivo efficacy testing in infection models

Synergistic approaches:

  • Combination therapy:

    • Testing respiratory inhibitors in combination with existing antibiotics

    • Identifying synergistic combinations that overcome resistance

    • Exploiting metabolic vulnerabilities created by respiratory inhibition

  • Alternative delivery strategies:

    • Nanoparticle-based delivery to increase penetration into A. baumannii biofilms

    • Siderophore conjugation for targeted delivery

    • Bacteriophage-based delivery of CRISPR systems targeting nuoK

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.