Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is the first enzyme in the bacterial lipoprotein biosynthesis pathway. It catalyzes the transfer of a diacylglyceryl (DG) group from phosphatidylglycerol to the conserved cysteine residue in the lipobox ([LVI][ASTVI][GAS]C) of preprolipoproteins . This lipid modification anchors lipoproteins to the bacterial cell membrane, enabling their roles in nutrient acquisition, virulence, and antibiotic resistance. In Acinetobacter baumannii, a multidrug-resistant pathogen, Lgt is essential for envelope biogenesis and survival .

Role of Lgt in A. baumannii Lipoprotein Biosynthesis

Lgt initiates lipoprotein maturation by attaching DG to the thiol group of the lipobox cysteine. This step is critical for downstream processing by LspA (prolipoprotein signal peptidase) and Lnt (N-acyl transferase) . Key findings include:

  • Lipoprotein localization: DG modification by Lgt ensures proper anchoring of lipoproteins to the inner or outer membrane. Loss of Lgt disrupts membrane integrity, leading to outer membrane vesicle (OMV) overproduction and increased serum sensitivity .

  • Essentiality: Unlike Lnt, Lgt is indispensable for A. baumannii growth. Depletion of Lgt causes severe cell division defects and loss of virulence .

  • Antibiotic synergy: Lgt-deficient strains exhibit heightened susceptibility to antibiotics (e.g., β-lactams) due to compromised membrane integrity .

Table 1: Functional Consequences of Lgt Depletion in A. baumannii

PhenotypeObservationSource
Growth defectSevere impairment in cell division and viability
Serum sensitivityIncreased susceptibility to human serum killing
OMV productionElevated outer membrane vesicle release
Antibiotic susceptibilityEnhanced sensitivity to β-lactams and colistin

Implications for Antibacterial Therapy

Lgt is a validated target for novel antibiotics due to its essentiality and conserved mechanism:

Challenges and Future Directions

  • Structural studies: High-resolution structures of A. baumannii Lgt are needed to guide inhibitor design.

  • Resistance monitoring: Mutations in lipoproteins (e.g., LirL) may confer cross-resistance to Lgt-targeting therapies .

  • Host-pathogen interactions: Role of Lgt in immune evasion and biofilm formation remains unexplored.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; A1S_0460; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Target Names
lgt
Target Protein Sequence
MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTSDMVSDLVFYGA LGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWF QTLDFVAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFGMIFPTDPLHLVRHPSQIYQA LCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFFRQPDADQGFILFGWMTKG QILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: acb:A1S_0460

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the enzymatic function of Lgt in Acinetobacter baumannii?

Lgt (Lipoprotein diacylglyceryl transferase) in A. baumannii catalyzes the first essential step in bacterial lipoprotein biosynthesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue (at the +1 position in the lipobox) in preprolipoproteins via a thioether bond . This modification occurs after the preprolipoprotein has been secreted through the inner membrane via either the Sec or Tat pathways. The Lgt-catalyzed reaction is fundamental to the proper processing and functioning of bacterial lipoproteins, which play crucial roles in bacterial envelope integrity, growth, and pathogenesis. The enzymatic activity of A. baumannii Lgt appears to be similar to that characterized in other Gram-negative bacteria, with the reaction releasing glycerol phosphate as a byproduct during the transfer of the diacylglyceryl group .

What are the key structural characteristics of A. baumannii Lgt?

While the search results don't provide detailed structural information specifically about A. baumannii Lgt, research indicates that Lgt proteins are relatively conserved across Gram-negative bacteria. The A. baumannii Lgt shares approximately 48.6% sequence identity with Escherichia coli Lgt . This level of conservation suggests similar structural features while potentially having species-specific characteristics that might influence substrate specificity or inhibitor binding.

Lgt is an inner membrane protein with multiple transmembrane domains that position the active site to access both the phosphatidylglycerol substrate from the membrane and the preprolipoprotein substrate emerging from the Sec or Tat translocation machinery. The enzyme must precisely recognize the lipobox motif and specifically modify the conserved cysteine residue. The functional conservation of Lgt is demonstrated by complementation studies showing that expression of A. baumannii Lgt can rescue growth in E. coli strains depleted of their native Lgt .

How does inhibition of A. baumannii Lgt compare to inhibition of downstream enzymes in terms of resistance development?

The reason for this difference likely relates to the biochemical consequences of pathway inhibition. When LspA is inhibited, unprocessed prolipoproteins accumulate in the inner membrane, particularly peptidoglycan-linked Lpp, causing toxicity. Deletion of lpp eliminates this toxic accumulation, allowing bacterial survival despite LspA inhibition . In contrast, Lgt inhibition does not lead to significant accumulation of peptidoglycan-linked Lpp in the inner membrane, making lpp deletion ineffective as a resistance mechanism .

In A. baumannii specifically, resistance to LspA inhibitors has been associated with mutations in a previously uncharacterized lipoprotein called LirL (LspA inhibitor resistance Lipoprotein) . This highlights the importance of understanding the entire lipoprotein processing system when developing inhibitors targeting this pathway.

What experimental approaches are most effective for measuring recombinant A. baumannii Lgt activity?

Several experimental approaches have proven effective for measuring Lgt enzymatic activity:

  • Glycerol Phosphate Release Assay: This method measures the release of glycerol phosphate (either G1P or G3P), which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . The detection can be coupled to a luciferase reaction for enhanced sensitivity. This approach allows for quantitative assessment of enzyme kinetics and inhibitor potency.

  • Mass Spectrometry Analysis: This technique directly confirms the addition of the diacylglyceryl moiety (552 Da) to peptide substrates containing the lipobox motif . For example, using peptide substrates derived from lipoproteins such as Pal (Pal-IAAC) allows for precise detection of the modified product.

  • SDS-PAGE Analysis: Complementary to mass spectrometry, this approach can detect the mobility shift of peptide substrates after diacylglyceryl modification, confirming Lgt activity . The modified peptides show reduced electrophoretic mobility compared to unmodified substrates.

  • In Vivo Complementation: Genetic systems where A. baumannii Lgt expression rescues growth in conditional Lgt-depleted strains can indirectly assess functional activity . This approach is particularly useful for evaluating the biological relevance of specific mutations or inhibitor effects.

For inhibitor screening and characterization, a combination of these methods provides comprehensive validation. The glycerol phosphate release assay is particularly suitable for high-throughput screening, while mass spectrometry and SDS-PAGE provide definitive confirmation of substrate modification.

How do mutations in Lgt affect A. baumannii pathogenesis and antibiotic susceptibility?

While the search results don't directly address specific mutations in A. baumannii Lgt, research on Lgt depletion provides insights into its importance for pathogenesis and antibiotic susceptibility. Even modest depletion of Lgt (approximately 25%) is sufficient to cause loss of bacterial viability , suggesting that mutations reducing Lgt activity would significantly impact bacterial fitness.

In E. coli, strains expressing only 90% of normal Lgt levels showed significantly increased sensitivity to complement-mediated killing, despite being normally serum-resistant . This indicates that even subtle reductions in Lgt function can compromise bacterial defense mechanisms against host immunity. By extension, A. baumannii with impaired Lgt function would likely show reduced virulence and increased susceptibility to host defense mechanisms.

Regarding antibiotic susceptibility, proper lipoprotein processing is crucial for maintaining cell envelope integrity and function. Mutations in Lgt could potentially alter membrane composition and permeability, possibly affecting susceptibility to antibiotics, particularly those targeting cell envelope processes. As A. baumannii is already known for its ability to develop multidrug resistance through various mechanisms including efflux pumps, porin mutations, and antibiotic-modifying enzymes , any disruptions to membrane integrity through Lgt mutations might interact with these resistance mechanisms in complex ways.

What expression systems are optimal for producing recombinant A. baumannii Lgt?

Based on research methodologies for studying bacterial membrane proteins, several expression systems can be considered for recombinant A. baumannii Lgt production:

  • E. coli-Based Expression Systems: The demonstrated functional complementation of E. coli Lgt by A. baumannii Lgt suggests that E. coli provides an appropriate environment for expressing functional A. baumannii Lgt . Expression vectors with tunable promoters (such as arabinose-inducible systems) allow controlled expression levels, which is important for membrane proteins that can be toxic when overexpressed.

  • Cell-Free Expression Systems: For biochemical and structural studies, cell-free systems supplemented with appropriate lipids or detergents can be useful for producing membrane proteins like Lgt without cellular toxicity concerns.

  • Homologous Expression: Expression within A. baumannii itself may provide the most native conditions for proper folding and function, particularly using regulated expression systems to control protein levels.

Key considerations for optimizing expression include:

  • Using fusion tags (His, MBP, etc.) positioned to avoid interference with membrane insertion

  • Careful selection of detergents for extraction that maintain enzymatic activity

  • Temperature modulation during expression to balance yield and proper folding

  • Codon optimization if using heterologous expression systems

The choice of expression system should be guided by the intended application, with biochemical assays potentially tolerating heterologous expression while functional studies might require more native conditions.

What assays are most reliable for screening inhibitors of A. baumannii Lgt?

Several complementary assays provide reliable data for screening and characterizing A. baumannii Lgt inhibitors:

  • Biochemical Assays:

    • Glycerol Phosphate Release Assay: This coupled enzymatic assay monitors the release of glycerol phosphate during the Lgt-catalyzed reaction and can be adapted for high-throughput screening . The assay can detect both G1P and G3P released from phosphatidylglycerol as Lgt catalyzes the reaction.

    • Mass Spectrometry-Based Assays: These directly detect the addition of the diacylglyceryl moiety to peptide substrates, providing definitive evidence of inhibition .

  • Cell-Based Assays:

    • Growth Inhibition Assays: Testing compounds for their ability to inhibit A. baumannii growth, with confirmation that growth inhibition results from Lgt targeting.

    • Target Engagement Assays: Assessing accumulation of unmodified preprolipoprotein substrates in cells treated with potential inhibitors.

  • Validation Assays:

    • Resistance Development Studies: Evaluating whether resistance mechanisms associated with downstream enzyme inhibitors (e.g., lpp deletion) confer protection against Lgt inhibitors.

    • Combination Studies: Testing Lgt inhibitors in combination with other antibiotics to identify synergistic effects.

When screening inhibitors, it's important to include appropriate controls such as known inhibitors (e.g., G2824, which has been identified as an Lgt inhibitor in E. coli) and to evaluate inhibitor specificity by comparing effects on related enzymes in the lipoprotein processing pathway.

How can researchers effectively evaluate the in vivo efficacy of Lgt inhibitors against A. baumannii infections?

Evaluating the in vivo efficacy of Lgt inhibitors against A. baumannii requires a comprehensive approach:

  • Animal Infection Models:

    • Pneumonia models (as respiratory tract infections are common for A. baumannii)

    • Bloodstream infection models (reflecting another common clinical manifestation)

    • Wound infection models (particularly relevant for battlefield or trauma-associated infections)

    • Intracranial infection models (A. baumannii can cause meningitis)

  • Pharmacokinetic/Pharmacodynamic Studies:

    • Determination of inhibitor concentrations in relevant tissues

    • Correlation of tissue concentrations with bacterial load reduction

    • Evaluation of dosing regimens that maintain effective concentrations

  • Resistance Development Assessment:

    • Monitoring for emergence of resistant strains during treatment

    • Characterization of any resistance mechanisms that develop

    • Comparison of resistance development rates with other antibiotic classes

  • Efficacy Endpoints:

    • Reduction in bacterial burden in infected tissues

    • Survival improvement in lethal infection models

    • Resolution of infection biomarkers

    • Prevention of dissemination from primary infection site

A. baumannii presents specific challenges for in vivo testing due to its adaptability, biofilm formation capability, and rapid development of resistance . Researchers should consider using clinical isolates with varying resistance profiles rather than laboratory strains alone, as A. baumannii clinical isolates often have enhanced virulence and resistance characteristics compared to laboratory-adapted strains.

How might Lgt inhibitors overcome existing antibiotic resistance mechanisms in A. baumannii?

A. baumannii has developed resistance to virtually all conventional antibiotics through multiple mechanisms, including efflux pumps, porin mutations, antibiotic-targeting enzymes (β-lactamases, carbapenemases), and modifications to antibiotic targets . Lgt inhibitors represent a promising approach to overcoming these resistance mechanisms for several reasons:

  • Novel Target: As a previously unexploited antibacterial target, Lgt inhibitors would not be affected by existing resistance mechanisms that specifically target other antibiotic classes .

  • Essential Pathway Disruption: Lipoprotein biosynthesis is critical for bacterial envelope integrity and function. Even modest depletion of Lgt (approximately 25%) has been shown to be lethal, suggesting a low probability of bacteria developing resistance while maintaining viability .

  • Resistance Barrier: Unlike inhibitors of downstream enzymes in the lipoprotein biosynthesis pathway (LspA, LolCDE), Lgt inhibition appears less susceptible to rescue by common resistance mechanisms such as lipoprotein gene deletions . This unique characteristic suggests a higher genetic barrier to resistance.

  • Membrane Disruption: By interfering with proper lipoprotein processing, Lgt inhibitors may destabilize the bacterial membrane, potentially enhancing the activity of other antibiotics that normally struggle to penetrate the A. baumannii outer membrane.

The development of Lgt inhibitors could potentially address the urgent need for new therapeutic options against multidrug-resistant and even pan-resistant A. baumannii strains, which currently pose significant challenges in healthcare settings worldwide .

What are the most promising directions for future research on A. baumannii Lgt?

Future research on A. baumannii Lgt should focus on several high-priority areas:

  • Structural Characterization: Determining the three-dimensional structure of A. baumannii Lgt would greatly facilitate rational inhibitor design and understanding of species-specific features that might be exploited for selective targeting.

  • Resistance Mechanism Investigation: While initial evidence suggests that common resistance mechanisms against other lipoprotein pathway inhibitors may not apply to Lgt inhibitors, comprehensive studies are needed to understand potential alternative resistance pathways.

  • Substrate Specificity: Detailed characterization of A. baumannii Lgt substrate preferences could reveal important insights for inhibitor design and potential differences from other bacterial species.

  • Lipoprotein Repertoire Analysis: Comprehensive identification of A. baumannii lipoproteins and their functions would help understand the full consequences of Lgt inhibition and potentially identify additional targets in lipoprotein-dependent pathways.

  • Combination Therapy Approaches: Investigation of synergistic effects between Lgt inhibitors and existing antibiotics could lead to more effective treatment strategies for multidrug-resistant A. baumannii infections.

  • Inhibitor Development Pipeline: Continued screening and optimization of Lgt inhibitors like G2824 identified in E. coli should be extended to A. baumannii, with attention to species-specific differences that might affect inhibitor efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.