Recombinant Acinetobacter baumannii Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The recombinant enzyme is produced via in vitro E. coli expression systems :

  • Expression Vector: pRK415-derived plasmids with cloned htpX gene.

  • Purification: Affinity chromatography using His-tag under denaturing conditions, followed by refolding in zinc chelator-containing buffers .

  • Storage: Stable at -20°C for short-term; long-term storage at -80°C recommended.

Functional Role in Antibiotic Resistance

HtpX is upregulated in multidrug-resistant A. baumannii under aminoglycoside stress (e.g., amikacin), where it collaborates with chaperones like DnaK to counteract antibiotic-induced protein misfolding . Key findings:

  • Amikacin Response: Transcriptomic studies show htpX is co-upregulated with dnaK and Clp proteases during amikacin exposure, enhancing bacterial survival .

  • Resistance Mechanism: Degrades misfolded proteins caused by aminoglycoside-induced translational errors, reducing cellular stress .

Comparative Analysis with Homologs

HtpX shares functional similarities with proteases in other pathogens:

  • E. coli HtpX: Zinc-dependent, membrane-localized, and synergizes with FtsH protease for quality control .

  • Pseudomonas aeruginosa FtsH: Mutations increase aminoglycoside susceptibility, analogous to HtpX’s role in A. baumannii .

Potential as a Therapeutic Target

Inactivation of htpX in Stenotrophomonas maltophilia (a related Gram-negative pathogen) significantly reduces aminoglycoside resistance, suggesting that targeting HtpX could enhance antibiotic efficacy . For A. baumannii, this implies:

  • Adjuvant Development: Inhibiting HtpX could sensitize strains to existing aminoglycosides .

  • Resistance Reversal: Combined deletion of htpX and clpA (cytoplasmic protease) causes a 16-fold reduction in kanamycin MIC .

Research Gaps and Future Directions

  • Structural Studies: Full 3D structure of HtpX remains unresolved.

  • In Vivo Role: Limited data on HtpX’s interaction with other resistance mechanisms (e.g., efflux pumps) .

  • Inhibitor Screening: No known HtpX-specific inhibitors have been reported.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it according to your request.
Synonyms
htpX; A1S_2658; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Target Names
htpX
Target Protein Sequence
MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLVSLFMS KWMAKKTTGTELIDPNAPRNQAESWLLQTVAELSQRAGINMPEVGIFPSYQSNAFATGWN KNDALVAVSSGLLERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDNEAPGMGYFIITMVLDIVFGILASAIVMWFSRYREYRADEAGARLAGKQ AMISALLRLQAETELPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPTIEQRVAALHQLDC P
Uniprot No.

Target Background

Database Links

KEGG: acb:A1S_2658

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what role does it play in Acinetobacter baumannii?

HtpX is a membrane-bound zinc metalloprotease that plays a critical role in bacterial stress response and protein quality control. In Acinetobacter baumannii, HtpX appears to be involved in antibiotic resistance mechanisms, particularly against aminoglycosides. Similar to its function in other bacteria, HtpX in A. baumannii is likely responsible for degrading misfolded membrane proteins that accumulate during cellular stress, including antibiotic exposure. This protein belongs to a group of stress response-related proteins that are differentially expressed between multidrug-resistant and drug-susceptible A. baumannii strains . Understanding HtpX function is particularly important given that A. baumannii is responsible for approximately 400,000 deaths annually worldwide and is a major concern in healthcare settings, especially for immunocompromised patients .

How does HtpX contribute to antibiotic resistance in bacterial pathogens?

HtpX has been identified as a primary determinant responsible for intrinsic aminoglycoside resistance in bacteria. Research on related bacterial species has shown that the htpX gene is upregulated in response to kanamycin exposure, suggesting its involvement in antibiotic stress response . When the htpX gene is inactivated, protease-mediated intrinsic aminoglycoside resistance is compromised, validating its importance in this resistance mechanism .

HtpX likely contributes to antibiotic resistance through multiple mechanisms:

  • Degradation of misfolded membrane proteins caused by antibiotic stress

  • Maintenance of membrane integrity during stress conditions

  • Possible interaction with efflux pump systems, as evidenced by its ability to affect SmeYZ pump-mediated aminoglycoside resistance in Stenotrophomonas maltophilia

  • Participation in broader stress response pathways that enhance bacterial survival

This makes HtpX a potential target for developing antibiotic adjuvants to combat multidrug-resistant A. baumannii infections.

How is HtpX regulated in response to environmental stressors?

The transcriptional regulation of htpX is directly linked to stress conditions, particularly antibiotic exposure. Experimental data shows that htpX is upregulated in response to aminoglycoside antibiotics like kanamycin . This regulation appears to be part of a coordinated stress response that includes other proteases and chaperones.

The regulation pattern of htpX shows similarities to other stress response genes in A. baumannii. Comparative proteomic analyses have revealed that numerous stress response-related proteins exhibit differential expression between multidrug-resistant and drug-susceptible isolates . This suggests that the regulatory mechanisms controlling htpX expression may be altered in resistant strains, potentially contributing to their enhanced survival capabilities.

To systematically study htpX regulation, researchers typically employ quantitative RT-PCR using internal parameters such as rpoB for normalization, as described in methodologies for analyzing differential gene expression in A. baumannii .

What are the optimal conditions for expressing recombinant A. baumannii HtpX in heterologous systems?

Based on established protocols for expressing membrane proteins from A. baumannii, the following optimized conditions are recommended for recombinant HtpX expression:

Expression System:

  • E. coli BL21(DE3) cells have proven effective for expressing A. baumannii proteins

  • Vectors such as pET-21a(+) with C-terminal His-tag facilitate purification while minimally affecting protein function

  • For co-expression systems, pCDF vectors can be used in conjunction with pET vectors

Culture Conditions:

  • Grow cultures in rich media such as terrific broth (TB) at 37°C until OD600 reaches 0.5-0.6

  • Induce with IPTG at a final concentration of 0.5 mM

  • Shift to lower temperature (20°C) post-induction and continue expression for 18 hours

  • Consider supplementing with specific cofactors (like zinc) to enhance proper folding of the metalloprotease

Extraction and Purification:

  • Solubilize membrane fractions with appropriate detergents (DDM, LMNG)

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

  • Include protease inhibitors to prevent degradation during purification

This expression protocol should be optimized through small-scale expression tests monitoring protein yield, solubility, and enzymatic activity.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of HtpX?

Site-directed mutagenesis is a powerful approach to elucidate the structure-function relationship of HtpX. The following methodology can be adapted from successful mutagenesis protocols used for other A. baumannii proteins :

Key Residues for Mutagenesis:

  • The catalytic HEXXH motif typical of zinc metalloproteases

  • Conserved transmembrane residues potentially involved in substrate recognition

  • Zinc-coordinating residues essential for catalytic activity

Experimental Protocol:

  • Design primers containing desired mutations following established PCR strategies

  • Amplify the htpX gene with mutagenic primers

  • Transform the mutated plasmid into E. coli

  • Verify mutations by DNA sequencing

  • Express and purify mutant proteins using protocols similar to wild-type

Functional Characterization:

  • Compare proteolytic activity of wild-type and mutant HtpX proteins

  • Assess structural integrity using circular dichroism

  • Determine zinc binding capacity using colorimetric assays

  • Evaluate the impact of mutations on antibiotic resistance by complementing htpX knockout strains

This approach allows systematic mapping of residues critical for HtpX function and provides insights into potential inhibitor design strategies.

What approaches can be used to identify the substrate specificity of HtpX in A. baumannii?

Understanding HtpX substrate specificity is crucial for elucidating its biological role. The following complementary approaches are recommended:

Comparative Proteomics:

  • Generate htpX knockout strains using established genetic manipulation techniques

  • Compare proteomes of wild-type and ΔhtpX strains using Label-free or TMT labeling approaches as described for A. baumannii

  • Identify proteins that accumulate in the ΔhtpX strain, indicating potential substrates

  • Classify differential proteins into functional categories (membrane proteins, stress response proteins, etc.)

In Vitro Degradation Assays:

  • Purify recombinant HtpX following established protocols for membrane proteins

  • Incubate with candidate substrate proteins under controlled conditions

  • Analyze degradation patterns using SDS-PAGE or mass spectrometry

  • Confirm specificity by comparing with inactive HtpX mutants

Crosslinking-Mass Spectrometry:

  • Express tagged HtpX in A. baumannii

  • Perform in vivo crosslinking to capture transient enzyme-substrate interactions

  • Purify HtpX complexes and identify interacting partners by mass spectrometry

  • Validate direct interactions using reciprocal co-immunoprecipitation

These approaches provide complementary data to build a comprehensive picture of HtpX substrate preferences.

How does HtpX interact with other proteases and quality control systems in A. baumannii?

HtpX functions within a complex network of proteases and chaperones that collectively maintain protein homeostasis. Based on studies in related bacteria, HtpX likely cooperates with cytoplasmic proteases like ClpP, ClpA, and ClpS, which are also upregulated during aminoglycoside exposure .

Experimental Approaches to Study Protease Networks:

  • Genetic Interaction Analysis:

    • Generate single and double knockouts of htpX and other protease genes (clpP, clpA, clpS)

    • Compare phenotypes to identify synthetic lethal or suppressor interactions

    • This approach has been successful in identifying functional relationships between HtpX and other proteases in S. maltophilia

  • Co-expression Analysis:

    • Monitor expression patterns of multiple protease genes under various stress conditions

    • Identify coordinately regulated proteases using qRT-PCR methods

    • Construct regulatory networks based on expression correlation

  • Protein-Protein Interaction Studies:

    • Perform co-immunoprecipitation experiments with tagged HtpX

    • Use bacterial two-hybrid systems to test direct interactions

    • Apply proximity labeling approaches to identify physically associated proteins

ProteaseFunctionInteraction with HtpXContribution to Antibiotic Resistance
ClpAATP-dependent chaperoneFunctional redundancyMajor determinant of aminoglycoside resistance
ClpPProteolytic component of Clp proteasePotential cooperativityUpregulated during antibiotic stress
ClpSAdaptor protein for ClpARegulatory relationshipUpregulated during antibiotic stress
LonATP-dependent proteaseUnknownStress response protease
FtsHMembrane-bound zinc metalloproteasePotential functional overlapMembrane protein quality control

Understanding these interactions helps elucidate the broader role of HtpX in bacterial physiology and stress response.

What are the recommended protocols for purifying recombinant HtpX while maintaining its structural integrity?

Purifying membrane proteins like HtpX requires specialized approaches to maintain structural integrity and enzymatic activity. Based on successful protocols for membrane proteins from A. baumannii :

Cell Lysis and Membrane Isolation:

  • Harvest E. coli cells expressing HtpX after optimal induction period

  • Resuspend cells in buffer containing protease inhibitors

  • Lyse cells by sonication or French press

  • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

Membrane Protein Solubilization:

  • Resuspend membrane pellet in solubilization buffer containing appropriate detergent

  • Test multiple detergents: n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or CHAPS

  • Incubate with gentle agitation for 1-2 hours at 4°C

  • Remove insoluble material by ultracentrifugation

Affinity Purification:

  • Apply solubilized membrane extract to Ni-NTA resin for His-tagged HtpX

  • Wash extensively with buffer containing low imidazole (20-40 mM) and detergent (0.05-0.1%)

  • Elute with high imidazole (250-500 mM)

  • Dialyze or desalt to remove imidazole

Size Exclusion Chromatography:

  • Further purify by gel filtration to remove aggregates and ensure monodispersity

  • Analyze fractions by SDS-PAGE for purity assessment

  • Pool fractions containing pure, properly folded HtpX

Quality Control:

  • Verify protein identity by mass spectrometry

  • Confirm zinc content using colorimetric assays

  • Assess enzymatic activity using appropriate substrates

  • Check for proper folding using circular dichroism

This protocol should be optimized based on the specific properties of HtpX from A. baumannii to ensure maximum yield of active protein.

What gene knockout strategies are most effective for studying htpX function in A. baumannii?

Creating clean gene deletions is crucial for studying HtpX function. Based on successful gene deletion approaches in related bacteria :

Suicide Vector Strategy:

  • Design deletion construct with ~1 kb homology arms flanking the htpX gene

  • Clone the construct into a suicide vector like pEX18Tc that contains sacB for counter-selection

  • Introduce the vector into A. baumannii via conjugation using helper strains like E. coli S17-1

  • Select for single crossover events on appropriate antibiotics

  • Counter-select for double crossover events on media containing sucrose

  • Confirm deletion by PCR and sequencing

Key Considerations:

  • Include at least 800-1000 bp homology arms for efficient recombination

  • Design deletions to maintain the reading frame of downstream genes

  • Consider creating an unmarked deletion to avoid polar effects

  • Prepare multiple mutant strains including single htpX deletion and double deletions with related proteases

Validation Approaches:

  • PCR verification using primers flanking the deletion site

  • RT-PCR to confirm absence of transcript

  • Western blotting to verify protein absence

  • Complementation with wild-type htpX to confirm phenotype specificity

  • Whole genome sequencing to rule out off-target mutations

This genetic approach allows for clean dissection of HtpX function in A. baumannii.

How can quantitative RT-PCR be optimized for studying htpX expression in different A. baumannii strains?

Quantitative RT-PCR is an essential tool for analyzing htpX expression patterns. Based on established protocols for A. baumannii gene expression studies :

RNA Extraction and Quality Control:

  • Grow A. baumannii strains under standardized conditions (e.g., LB broth, 37°C)

  • Harvest cells at mid-logarithmic phase (OD600 ~0.5)

  • Extract total RNA using phenol-based methods or commercial kits like RNAprep Pure Kit

  • Assess RNA integrity by agarose gel electrophoresis or Bioanalyzer

  • Treat with DNase to remove genomic DNA contamination

cDNA Synthesis:

  • Use high-quality reverse transcriptase like that in the All-in-One™ First-Strand cDNA Synthesis Kit

  • Include appropriate controls (no-RT, no-template)

  • Use random hexamers or gene-specific primers depending on experimental needs

qRT-PCR Design:

  • Design primers specific to htpX with optimal characteristics:

    • Amplicon size: 80-150 bp

    • Tm: 58-62°C

    • GC content: 40-60%

  • Select appropriate reference genes (rpoB has been validated for A. baumannii)

  • Use a validated master mix such as 2*SYBR Green qPCR Master Mix

Data Analysis:

  • Calculate relative expression using the 2^(-ΔΔCT) method

  • Normalize to reference gene expression

  • Include at least three biological replicates

  • Apply appropriate statistical analyses to determine significance

This protocol ensures reliable quantification of htpX expression across different A. baumannii strains and conditions.

What cell-based assays can be used to evaluate the functional impact of HtpX on antibiotic resistance?

To establish the role of HtpX in antibiotic resistance, several complementary cell-based assays can be employed:

Minimum Inhibitory Concentration (MIC) Determination:

  • Compare MICs of various antibiotics (especially aminoglycosides) between wild-type, ΔhtpX, and complemented strains

  • Follow standard broth microdilution methods

  • Include appropriate quality control strains

  • Test under various stress conditions to reveal conditional phenotypes

Time-Kill Kinetics:

  • Expose bacterial cultures to antibiotics at different concentrations

  • Sample at defined time points (0, 2, 4, 8, 24 hours)

  • Determine viable counts by plating on appropriate media

  • Compare killing rates between wild-type and ΔhtpX strains

Membrane Integrity Assays:

  • Use fluorescent dyes like propidium iodide to assess membrane damage

  • Compare membrane integrity between wild-type and ΔhtpX strains following antibiotic treatment

  • Analyze by flow cytometry for quantitative assessment

Transcriptional Reporter Assays:

  • Construct promoter-reporter fusions (e.g., htpX promoter-GFP)

  • Monitor expression dynamics in response to antibiotic challenge

  • Compare reporter activity across different genetic backgrounds

  • Use flow cytometry or plate readers for quantitative analysis

These assays collectively provide a comprehensive assessment of HtpX's contribution to antibiotic resistance phenotypes in A. baumannii.

What are the common challenges in expressing functional recombinant HtpX and how can they be addressed?

Membrane proteins like HtpX present several expression challenges that require systematic troubleshooting:

Challenge: Low Expression Levels

  • Solution: Optimize codon usage for the expression host

  • Solution: Try different promoter systems (T7, tac, araBAD)

  • Solution: Screen multiple E. coli strains (BL21, C41, C43, Rosetta)

  • Solution: Reduce growth temperature post-induction to 16-20°C

Challenge: Protein Aggregation/Inclusion Bodies

  • Solution: Express as fusion with solubility enhancers (MBP, SUMO, Trx)

  • Solution: Optimize induction conditions (lower IPTG concentration, longer expression time)

  • Solution: Co-express with molecular chaperones

  • Solution: Try cell-free expression systems for direct incorporation into detergent micelles

Challenge: Protein Instability/Degradation

  • Solution: Include protease inhibitors throughout purification

  • Solution: Add stabilizing agents (glycerol, specific lipids)

  • Solution: Maintain cold temperatures during all purification steps

  • Solution: Consider adding zinc to buffers to stabilize the metalloprotease domain

Challenge: Loss of Activity During Purification

  • Solution: Verify zinc content and supplement if necessary

  • Solution: Test different detergents for optimal activity retention

  • Solution: Minimize exposure to harsh conditions (extreme pH, high salt)

  • Solution: Consider reconstitution into nanodiscs or liposomes to provide native-like membrane environment

Careful optimization of these parameters typically yields sufficient functional protein for downstream applications.

How should researchers interpret discrepancies between in vitro and in vivo findings regarding HtpX function?

Discrepancies between in vitro and in vivo results are common when studying membrane proteases and require careful interpretation:

Common Discrepancies and Interpretation Frameworks:

  • Different Substrate Preferences:

    • In vitro: Limited substrate set, controlled conditions

    • In vivo: Complex substrate pool, competitive environment

    • Interpretation: Identify physiologically relevant substrates through comparative proteomics of wild-type and ΔhtpX strains

  • Activity Differences:

    • In vitro: Isolated enzyme in detergent micelles

    • In vivo: Membrane-embedded protein with natural lipid composition

    • Interpretation: Reconstitute into liposomes with A. baumannii lipid composition for more relevant in vitro assays

  • Genetic Redundancy:

    • In vitro: Single enzyme activity

    • In vivo: Compensatory mechanisms from other proteases

    • Interpretation: Generate multiple knockout strains as described for S. maltophilia to assess redundancy

  • Regulatory Context:

    • In vitro: Constitutive activity

    • In vivo: Tightly regulated expression and activation

    • Interpretation: Study expression patterns under various conditions using qRT-PCR

Reconciliation Strategies:

  • Validate in vitro findings with complementary in vivo approaches

  • Consider strain-specific differences when extrapolating between experimental systems

  • Develop more physiologically relevant in vitro systems (membrane vesicles, spheroplasts)

  • Use genetic complementation to confirm specificity of observed phenotypes

By addressing these considerations, researchers can develop a more complete understanding of HtpX function.

What statistical approaches are most appropriate for analyzing proteomics data related to HtpX function?

For Differential Expression Analysis:

  • Normalize data appropriately based on the proteomics approach (label-free or TMT labeling)

  • Apply appropriate statistical tests:

    • Student's t-test for pairwise comparisons

    • ANOVA for multi-condition experiments

  • Control for multiple testing using Benjamini-Hochberg false discovery rate correction

  • Set appropriate significance thresholds (typically p < 0.05 and fold change > 1.5)

For Functional Enrichment Analysis:

  • Classify differentially expressed proteins into functional categories as demonstrated in A. baumannii studies :

    • Antibiotic resistance-related proteins

    • Membrane proteins and transporters

    • Stress response proteins

    • Proteins involved in gene expression and translation

    • Metabolism-related proteins

  • Perform Gene Ontology enrichment analysis

  • Use pathway analysis tools to identify affected biological processes

For Validation Experiments:

  • Calculate appropriate sample sizes using power analysis

  • Include sufficient biological replicates (minimum n=3)

  • Apply significance tests consistent with experimental design

  • Report both statistical significance (p-values) and effect sizes

For Multi-omics Integration:

  • Calculate correlation coefficients between protein and transcript levels

  • Apply dimensionality reduction techniques for visualization

  • Use network analysis to identify key regulatory nodes

Following these statistical approaches ensures robust interpretation of complex proteomics datasets involving HtpX function.

How can researchers reconcile contradictory findings about HtpX function across different A. baumannii strains?

A. baumannii exhibits significant strain-to-strain variation, which can lead to apparently contradictory findings regarding HtpX function. Strategic approaches to reconcile such discrepancies include:

Genetic Analysis:

  • Sequence the htpX gene and regulatory regions across strains to identify polymorphisms

  • Perform comparative genomic analysis to identify strain-specific genetic contexts

  • Create phylogenetic trees to understand evolutionary relationships between strains

  • Analyze horizontal gene transfer events that might affect htpX function or regulation

Experimental Standardization:

  • Use identical culture conditions when comparing strains

  • Standardize protein extraction and activity assay protocols

  • Ensure comparable antibiotic exposure conditions

  • Include reference strains across experiments for baseline comparisons

Cross-Strain Complementation:

  • Express htpX from one strain in the ΔhtpX background of another strain

  • Assess whether function is restored to determine if differences are due to HtpX itself or genetic background

  • Create chimeric HtpX proteins to map domains responsible for strain-specific functions

Contextual Analysis:

By systematically addressing these factors, researchers can develop a more nuanced understanding of HtpX function that accounts for strain-specific adaptations.

What are the most promising future research directions for understanding HtpX function in A. baumannii?

Based on current knowledge and experimental approaches, several high-priority research directions emerge for advancing our understanding of HtpX in A. baumannii:

  • Comprehensive Substrate Identification: Applying advanced proteomics techniques to identify the complete set of HtpX substrates in A. baumannii under various stress conditions, particularly during antibiotic exposure . This will clarify the protein's role in stress response and antibiotic resistance.

  • Structure-Function Analysis: Determining the three-dimensional structure of HtpX using approaches such as cryo-electron microscopy or X-ray crystallography, enabling rational inhibitor design for potential therapeutic applications.

  • Integration with Resistance Mechanisms: Investigating how HtpX interfaces with other known resistance mechanisms in A. baumannii, including efflux pumps, biofilm formation, and outer membrane modifications .

  • Development of Specific Inhibitors: Designing and testing small molecule inhibitors of HtpX as potential antibiotic adjuvants, building on the observation that HtpX is a determinant of aminoglycoside resistance .

  • In vivo Relevance: Evaluating the importance of HtpX in clinically relevant infection models to translate laboratory findings to potential clinical applications.

These research directions promise to enhance our understanding of A. baumannii pathogenesis and may lead to novel therapeutic strategies against this significant global health threat.

How might targeting HtpX contribute to combating multidrug-resistant A. baumannii infections?

HtpX represents a promising target for combating multidrug-resistant A. baumannii infections based on several key observations:

  • Direct Role in Resistance: HtpX has been identified as a primary determinant of aminoglycoside resistance in related bacteria, suggesting it may have a similar role in A. baumannii . Targeting HtpX could potentially restore susceptibility to existing antibiotics.

  • Stress Response Function: As a protein involved in stress response pathways, HtpX likely helps A. baumannii adapt to hostile environments, including those containing antibiotics . Inhibiting this adaptation mechanism could weaken the bacteria's survival capabilities.

  • Adjuvant Potential: HtpX inhibitors could serve as antibiotic adjuvants, as suggested by studies in S. maltophilia that identified HtpX as a potential aminoglycoside adjuvant target . This approach could revitalize the use of existing antibiotics.

  • Conservation Across Strains: If HtpX function is conserved across diverse A. baumannii strains, targeting it could provide a broad-spectrum approach against multiple clinical isolates.

  • Limited Host Homology: As a bacterial metalloprotease, HtpX likely has limited functional homology to human proteases, potentially allowing for selective targeting with minimal host toxicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.