Recombinant Acinetobacter sp. Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Disulfide Bond Formation Systems in Bacteria

The disulfide bond-forming system in Gram-negative bacteria typically comprises two key proteins: DsbA, a soluble periplasmic dithiol oxidoreductase with a thioredoxin fold, and DsbB, an integral inner membrane protein. This system functions as a critical pathway for proper protein folding in the bacterial periplasm. DsbA catalyzes disulfide bond formation in nascent substrate proteins as they enter the periplasmic space, while DsbB serves to reoxidize DsbA, restoring it to its functionally active state . This oxidation-reduction cycle is essential for maintaining the structural integrity and function of numerous periplasmic and secreted proteins, many of which are involved in bacterial virulence and survival.

In pathogenic bacteria like Acinetobacter baumannii, proper disulfide bond formation is crucial for various virulence mechanisms, including biofilm formation, which requires both the disulfide bond-forming pathway and chaperone-usher systems . The significance of this pathway is underscored by the fact that deletion or mutation of dsbA attenuates virulence factor maturation in several bacterial pathogens, highlighting the potential of targeting this system for therapeutic interventions.

Functional Mechanism in Bacterial Physiology

The functional cycle begins when DsbA catalyzes disulfide bond formation in substrate proteins by transferring its active site disulfide to paired cysteines in the target protein. This reaction leaves DsbA in a reduced state with free thiols. DsbB then reoxidizes DsbA by forming a mixed disulfide intermediate between them, followed by electron transfer to the respiratory chain. This continuous cycle ensures a constant supply of oxidized DsbA, which is essential for efficient disulfide bond formation in the periplasm.

In Acinetobacter species, this pathway likely functions similarly, supporting the proper folding of various virulence factors and contributing to pathogenicity and antibiotic resistance. The significance of the disulfide bond formation pathway in Acinetobacter baumannii is highlighted by its role in biofilm formation, a major virulence trait in this bacterium .

Expression Systems and Methodologies

While the search results don't provide specific protocols for recombinant expression of Acinetobacter DsbB, insights can be gained from successful expression strategies for related proteins. The expression of recombinant Acinetobacter baumannii DsbA (AbDsbA) involved a codon-optimized synthetic gene cloned into the pMCSG7 plasmid for expression in the bacterial cytoplasm of E. coli BL21(DE3) cells using autoinduction .

For membrane proteins like DsbB, additional considerations would include the use of specialized expression hosts, detergents for solubilization, and appropriate tags for purification. Based on successful expression of other Acinetobacter proteins, a potential methodology for recombinant DsbB expression might involve:

Expression ParameterDescription
Expression VectorModified pET vector with appropriate promoter and signal sequences
Host StrainE. coli C41(DE3) or C43(DE3) (specialized for membrane protein expression)
Induction MethodIPTG induction with optimization of temperature and concentration
SolubilizationDetergent screening (DDM, LDAO, etc.) for optimal protein extraction
Purification StrategyIMAC (Ni-NTA) followed by size exclusion chromatography
Quality AssessmentSDS-PAGE, Western blotting, and functional assays

Challenges in Membrane Protein Expression

The recombinant expression of membrane proteins like DsbB presents unique challenges compared to soluble proteins. These include potential toxicity to host cells, protein misfolding, aggregation, and difficulties in extraction from membranes. Strategies to overcome these challenges might include:

  1. Low-level expression to prevent toxicity

  2. Expression at reduced temperatures (16-25°C) to facilitate proper folding

  3. Fusion with solubility-enhancing tags (MBP, TrxA)

  4. Co-expression with chaperones to assist in protein folding

  5. Utilization of lipid nanodiscs or amphipols for stabilization

Similar strategies have been employed successfully for other membrane proteins from Acinetobacter species, suggesting their potential applicability for DsbB expression.

Biochemical Properties and Activity Assays

Recombinant Acinetobacter DsbB would require comprehensive functional characterization to confirm its oxidoreductase activity. Based on studies of AbDsbA, which has been characterized as a bona fide dithiol oxidase with unusual basic surface properties and specific redox and catalytic activities , several approaches could be employed to assess DsbB functionality:

Assay TypeDescriptionExpected Outcome for Functional DsbB
DsbA Oxidation AssayMonitoring the ability of DsbB to oxidize reduced DsbAIncrease in oxidized DsbA levels over time
Ubiquinone ReductionMeasuring the reduction of ubiquinone during DsbB catalysisDecrease in ubiquinone absorbance
Complementation StudiesExpression in DsbB-deficient bacterial strainsRestoration of disulfide bond-dependent phenotypes
Thermal Stability AnalysisDifferential scanning calorimetry or fluorimetryStability profile characteristic of properly folded membrane proteins

Interaction with Partner Proteins

A critical aspect of DsbB function is its interaction with DsbA. For Acinetobacter DsbB, characterizing this interaction would provide valuable insights into the species-specific aspects of the disulfide bond formation pathway. Techniques such as surface plasmon resonance, isothermal titration calorimetry, or cross-linking studies could help elucidate the binding kinetics and interaction interface between Acinetobacter DsbB and DsbA.

Interestingly, research on AbDsbA revealed an unexpected interaction with E. coli EF-Tu, allowing the crystal structure determination of the AbDsbA·EcEF-Tu complex at 2.15 Å resolution . This finding suggests that Acinetobacter DsbA, and potentially DsbB, might have additional interaction partners beyond the canonical disulfide bond formation pathway, which could be explored using pull-down assays or protein-protein interaction screens with the recombinant protein.

Crystallography and Structure Determination Approaches

While the crystal structure of Acinetobacter DsbB has not been reported in the provided search results, approaches used for AbDsbA structure determination provide a potential roadmap. The crystal structure of AbDsbA complexed with E. coli EF-Tu was solved using molecular replacement with PHASER, followed by iterative manual rebuilding, density modification, and refinement in PHENIX and COOT .

For membrane proteins like DsbB, crystallization presents additional challenges. Techniques that have proven successful for other membrane proteins include:

  1. Lipidic cubic phase crystallization

  2. Crystallization in detergent micelles

  3. Use of antibody fragments to stabilize flexible regions

  4. Crystallization of DsbB in complex with binding partners

Alternative structural determination methods such as cryo-electron microscopy or nuclear magnetic resonance spectroscopy could also be considered, particularly for capturing dynamic aspects of DsbB function.

DsbB as an Antivirulence Target

The disulfide bond formation pathway, including DsbB, represents a promising target for antivirulence strategies against Acinetobacter infections. DsbA is considered a master virulence determinant in bacterial pathogens, and DsbA inhibitors are potential antivirulence drugs . By extension, targeting DsbB could disrupt the disulfide bond formation pathway, potentially attenuating bacterial virulence without imposing strong selective pressure for resistance development.

Acinetobacter baumannii is a significant cause of nosocomial infections, with biofilm formation being a major virulence trait that requires functional disulfide bond formation . Inhibiting DsbB could potentially interfere with biofilm development and other virulence mechanisms, offering a novel approach to combat this troublesome pathogen.

Potential Inhibitor Development Strategies

Development of inhibitors targeting recombinant Acinetobacter DsbB could follow several strategies:

ApproachDescriptionPotential Advantages
Competitive InhibitorsMolecules competing with DsbA for binding to DsbBHigh specificity for the target interaction
Allosteric ModulatorsCompounds binding to secondary sites affecting DsbB functionMay overcome resistance to active site-directed inhibitors
Covalent InhibitorsMolecules forming irreversible bonds with catalytic cysteinesExtended duration of inhibition
Membrane-disrupting PeptidesPeptides interfering with DsbB membrane insertionNovel mechanism of action
Quinone AnalogsCompounds competing with ubiquinone for bindingDisruption of electron flow in the DsbB catalytic cycle

The development of such inhibitors would be facilitated by the availability of purified recombinant Acinetobacter DsbB for high-throughput screening and structural studies.

Combination Therapy Approaches

Inhibitors of the disulfide bond formation pathway could potentially synergize with conventional antibiotics. For instance, research has shown that phosphorylation is required for BfmR-mediated gene regulation, antibiotic resistance, and sepsis development in vivo in Acinetobacter baumannii . Targeting multiple pathways simultaneously, such as the BfmS-BfmR system and the disulfide bond formation pathway, might provide enhanced efficacy against resistant Acinetobacter infections.

Similarly, phage-derived depolymerases have shown promise against Acinetobacter baumannii infections . Combining such enzymes with DsbB inhibitors could potentially enhance bacterial clearance by simultaneously targeting the protective capsule and virulence factor maturation.

Comparative Analysis of DsbB Across Bacterial Species

Understanding the similarities and differences between Acinetobacter DsbB and its counterparts in other bacteria is essential for developing species-specific targeting strategies. Based on available information, we can construct a comparative analysis:

Bacterial SpeciesDsbB CharacteristicsFunctional ImplicationsTherapeutic Relevance
Escherichia coliFour transmembrane domains with conserved Cys-Xaa-Xaa-Cys motifsWell-characterized model systemEstablished template for inhibitor design
Acinetobacter baumanniiPredicted similar topology with potential species-specific variationsCritical for biofilm formation and virulencePotential target against multidrug-resistant strains
Bacillus subtilisKnown as BdbC (functional analog in Gram-positive bacteria)Involved in protein secretion and disulfide bond handling Different membrane architecture may influence targeting
Pseudomonas aeruginosaSimilar to E. coli DsbB but with subtle structural differencesContributes to virulence and antibiotic resistanceAnother important nosocomial pathogen target

These comparisons highlight both conserved features that could enable broad-spectrum inhibitor development and species-specific characteristics that might allow selective targeting of Acinetobacter DsbB.

Exploring Novel Therapeutic Applications

Beyond traditional inhibitor development, recombinant Acinetobacter DsbB could facilitate:

  1. Vaccine development using recombinant protein as an antigen

  2. Antibody-based therapeutic approaches targeting exposed epitopes

  3. Diagnostic applications for detecting Acinetobacter infections

  4. CRISPR-Cas based targeting of the dsbB gene in combination therapies

  5. Development of peptide inhibitors based on DsbA-DsbB interaction interfaces

Integration with Systems Biology Approaches

Understanding DsbB function in the context of broader cellular networks could provide insights into resistance mechanisms and potential combination therapies. The BfmS-BfmR two-component system, essential for multidrug resistance and virulence in Acinetobacter baumannii , likely interacts with the disulfide bond formation pathway in complex ways that merit further investigation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; ACIAD3548; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
dsbB
Target Protein Sequence
MQWSYRFVSGLLVLASIVGMTFALYLEHFKGLEPCPLCIFQRVGLMAMGIVALIAFLHNP VSNAFKRVYAFLATLGILWSVGVAIRHVWLQTLPPDQVPSCGPGLNYLLDALPLKTVLQQ VLQGSGECAAIHWTFLGQSLPVWSLAYFSLILLVCVWQLLRRYPVIVTKKK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Disulfide bond formation protein B (dsbB) in Acinetobacter species?

Disulfide bond formation protein B (dsbB) in Acinetobacter species functions as a membrane protein that reoxidizes DsbA after each catalytic cycle of disulfide bond formation. In the bacterial periplasm, this oxidative folding system is crucial for the proper folding of many secreted proteins, including virulence factors. In Acinetobacter baumannii, which constitutes approximately 80% of all Acinetobacter hospital-acquired infections, dsbB likely contributes to the pathogen's ability to maintain structural integrity of its virulence factors . The protein works by transferring electrons from reduced DsbA to ubiquinone in the respiratory chain, maintaining the oxidative environment necessary for disulfide bond formation in newly synthesized proteins.

How does dsbB differ between Acinetobacter baumannii and other Acinetobacter species?

While A. baumannii has received the most research attention due to its clinical significance, dsbB proteins across different Acinetobacter species show varying degrees of sequence homology. Based on phylogenetic analyses using rpoB gene sequencing, which has been demonstrated as the most accurate identification method for Acinetobacter species, closely related species such as A. pittii, A. calcoaceticus, and A. nosocomialis (which together account for 85.5% of non-A. baumannii isolates) likely have similar dsbB structures with subtle amino acid variations that might affect substrate specificity or regulatory mechanisms . These differences may correlate with the significantly lower antimicrobial resistance rates observed in non-A. baumannii isolates (2.6% resistance to carbapenems compared to much higher rates in A. baumannii) .

What expression systems are most effective for producing recombinant Acinetobacter sp. dsbB?

  • Expression Vector Selection: pET vector systems with T7 promoters provide controlled, high-level expression

  • Host Strain Optimization: C41(DE3) or C43(DE3) strains are preferred for membrane proteins like dsbB

  • Induction Conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations (0.1-0.5 mM) typically yield properly folded protein

  • Detergent Screening: A panel of detergents should be evaluated for optimal solubilization:

DetergentConcentration RangeAdvantagesLimitations
DDM0.5-2%Good for maintaining activityExpensive
LDAO0.5-1%Effective solubilizationMay destabilize some proteins
Triton X-1000.5-2%Cost-effectiveUV absorbance interference

The choice of expression system should be tailored to downstream applications, with considerations for maintaining the native conformation of this integral membrane protein.

How can I confirm the proper folding and activity of recombinant Acinetobacter dsbB?

Confirming proper folding and activity of recombinant Acinetobacter dsbB requires multiple complementary approaches:

  • Functional Assays: The oxidoreductase activity can be measured using a ubiquinone-coupled electron transfer assay that monitors the reduction of artificial electron acceptors like DCPIP (2,6-dichlorophenolindophenol).

  • Structural Analysis: Circular dichroism (CD) spectroscopy can verify the expected secondary structure composition (predominantly α-helical for membrane-spanning regions).

  • Thermal Stability Assessment: Differential scanning fluorimetry with appropriate membrane protein-compatible dyes can evaluate thermal stability under various buffer conditions.

  • Reconstitution Studies: Functional reconstitution into liposomes followed by activity measurements can confirm native-like behavior in a membrane environment.

  • Complex Formation: Co-purification or crosslinking studies with DsbA can verify proper interaction with its physiological partner.

When interpreting results, it's essential to compare with control proteins and consider that Acinetobacter sp. dsbB may have specific requirements for optimal activity that differ from better-characterized homologs in E. coli or other model organisms.

What is the relationship between dsbB expression and antibiotic resistance in Acinetobacter species?

The relationship between dsbB expression and antibiotic resistance in Acinetobacter species represents a complex interplay between protein folding and resistance mechanisms. Several key observations suggest important connections:

  • Virulence Factor Maturation: Properly folded outer membrane proteins, including efflux pumps that contribute to antibiotic resistance, rely on the disulfide bond formation pathway. When dsbB function is compromised, these proteins may fold incorrectly, potentially reducing resistance .

  • Plasmid-Mediated Resistance: A. baumannii is known to harbor multiple plasmids carrying antibiotic resistance markers. Some virulence factors encoded on these plasmids may require disulfide bonds for proper function .

  • Genetic Context: Recent research has identified dif-like recombination sites (pdif) flanking antibiotic resistance genes, which may facilitate the transfer of resistance determinants via Xer site-specific recombination. This suggests potential involvement of recombination near dsbB or disulfide-dependent proteins in horizontal gene transfer events .

The variability in resistance profiles between A. baumannii and non-A. baumannii isolates (with resistance rates to carbapenems at 2.6% for non-A. baumannii species) may partially reflect differences in their respective dsbB activities or regulation .

What purification strategies yield the highest purity and activity for recombinant Acinetobacter dsbB?

Purification of recombinant Acinetobacter dsbB presents challenges typical of membrane proteins but can be optimized using the following strategy:

  • Affinity Chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with His-tagged dsbB provides effective initial capture. Buffer optimization is critical:

Buffer ComponentRecommended RangePurpose
Detergent2-3× CMCMaintain solubility
Imidazole (wash)20-40 mMReduce non-specific binding
Imidazole (elution)250-500 mMElute target protein
Glycerol10-20%Enhance stability
NaCl300-500 mMReduce ionic interactions
  • Size Exclusion Chromatography: Secondary purification using SEC separates monomeric protein from aggregates and removes remaining contaminants.

  • Anion Exchange Chromatography: Optional tertiary purification step to achieve >95% purity if required.

  • Quality Control Checkpoints:

    • SDS-PAGE analysis after each step

    • Western blotting against His-tag or dsbB-specific antibodies

    • Activity assays to track functional protein yield

Critical factors for success include maintaining appropriate detergent concentrations throughout all steps and including reducing agents only when specifically investigating reduced states of the protein.

How can I design experiments to investigate the interplay between dsbB and plasmid-borne resistance genes in Acinetobacter baumannii?

Investigating the relationship between dsbB and plasmid-borne resistance genes requires a multifaceted approach:

  • Genetic Knockout and Complementation:

    • Generate dsbB deletion mutants in A. baumannii using CRISPR-Cas9 or homologous recombination

    • Complement with wild-type and mutant versions of dsbB

    • Measure changes in minimum inhibitory concentrations (MICs) for various antibiotics

    • Assess plasmid stability and copy number

  • Transcriptomic and Proteomic Analysis:

    • Compare RNA-seq profiles between wild-type and ΔdsbB strains

    • Use quantitative proteomics to identify proteins with altered abundance or redox state

    • Focus on membrane proteins and known resistance determinants

  • Plasmid Mobilization Studies:

    • Design reporter plasmids containing resistance genes flanked by dif-like recombination sites (pdif)

    • Measure transfer efficiency in the presence and absence of functional dsbB

    • Analyze the role of Xer site-specific recombination in mobilizing resistance genes

  • Protein-DNA Interaction Studies:

    • Use chromatin immunoprecipitation (ChIP) to identify dsbB-associated DNA regions

    • Assess if dsbB physically interacts with components of the Xer recombination system

This experimental framework should provide insights into whether dsbB plays a direct or indirect role in the dissemination of resistance genes in A. baumannii, which is particularly important given this organism's status as a reservoir of multiple plasmids carrying antibiotic resistance markers .

What structural features of Acinetobacter dsbB influence substrate specificity compared to other bacterial species?

The structural features of Acinetobacter dsbB that influence substrate specificity remain incompletely characterized but can be investigated through comparative structural biology approaches:

  • Homology Modeling and Molecular Dynamics:

    • Generate structural models based on known DsbB structures (e.g., E. coli DsbB, PDB: 2HI7)

    • Identify key differences in the transmembrane helices and periplasmic loops

    • Use molecular dynamics simulations to predict substrate-binding sites and conformational flexibility

  • Critical Residue Analysis:

    • Conserved CXXC motifs are essential for redox activity

    • Acinetobacter-specific residues may confer different redox potential compared to E. coli homologs

    • Surface charge distribution likely influences interaction with DsbA and other partners

  • Redox Potential Measurements:

    • Determine the standard redox potential of Acinetobacter dsbB using electrochemical methods

    • Compare with values from other species to identify thermodynamic differences

  • Chimeric Protein Studies:

    • Create domain-swapped variants between Acinetobacter and E. coli dsbB

    • Assess which regions confer species-specific activities

Acinetobacter baumannii's remarkable ability to acquire and disseminate resistance genes through plasmid transfer suggests its dsbB may have evolved unique features to support the folding of diverse acquired proteins, potentially contributing to its success as a multidrug-resistant pathogen.

How does the Xer recombination system interact with disulfide bond formation in the mobilization of resistance genes in Acinetobacter species?

The interaction between the Xer recombination system and disulfide bond formation in Acinetobacter species represents a frontier in understanding antimicrobial resistance transfer mechanisms:

  • Mechanistic Connection:

    • The Xer site-specific recombination system utilizes XerC and XerD recombinases to bind to dif sites, catalyzing DNA strand cleavage, exchange, and ligation

    • Recent discovery of dif-like recombination sites (pdif) flanking antibiotic resistance genes suggests a novel gene transfer system

    • The orientation of pdif sites determines whether the internal DNA segment undergoes excision (same orientation) or inversion (opposite orientation)

  • Experimental Approaches to Study Interactions:

    • Co-immunoprecipitation to identify potential physical interactions between dsbB and Xer recombination components

    • Redox proteomics to determine if Xer proteins contain disulfide bonds that might be substrates for the DSB system

    • Site-directed mutagenesis of cysteine residues in XerC/D to assess the importance of disulfide bonds for function

  • Functional Analysis:

    • Compare recombination efficiency between wild-type and dsbB mutant strains

    • Measure formation of circular intermediates (resistance gene cassettes) using PCR

    • Assess whether oxidative stress conditions affect recombination frequency

  • Clinical Relevance:

    • Analyze correlation between dsbB expression levels and frequency of resistance gene mobilization in clinical isolates

    • Evaluate potential of dsbB inhibitors as adjuvants to reduce resistance gene transfer

This research area is particularly significant given A. baumannii's reputation as a "reservoir of multiple plasmids carrying antibiotic resistance markers" and the concerning trend of increasing multidrug resistance in this pathogen.

What bioinformatic approaches are recommended for identifying and characterizing dsbB homologs across Acinetobacter species?

Identifying and characterizing dsbB homologs across Acinetobacter species requires sophisticated bioinformatic approaches:

  • Sequence-Based Identification:

    • BLASTP searches using established dsbB sequences as queries against Acinetobacter genomes

    • Profile hidden Markov models (HMMs) constructed from known dsbB sequences to identify distant homologs

    • Transmembrane topology prediction to confirm expected membrane protein architecture (4 transmembrane segments)

  • Phylogenetic Analysis:

    • Multiple sequence alignment using MAFFT with specific parameters for membrane proteins

    • Maximum-likelihood or Bayesian phylogenetic tree construction

    • Comparison with species phylogeny based on rpoB gene sequences, which has been demonstrated as the most accurate method for Acinetobacter species identification

  • Genomic Context Analysis:

    • Examination of conserved gene neighborhoods to identify synteny

    • Investigation of proximity to mobile genetic elements or resistance determinants

    • Identification of potential regulatory elements in promoter regions

  • Structural Prediction:

    • Secondary structure prediction to identify conserved α-helical transmembrane domains

    • Homology modeling based on available crystal structures

    • Prediction of critical functional residues using evolutionary conservation mapping

When applying these approaches, special attention should be given to distinguishing between A. baumannii and closely related species within the Acb complex (A. pittii, A. calcoaceticus, and A. nosocomialis), as phenotypic identification methods often fail to accurately differentiate these species .

What are the optimal conditions for studying dsbB-mediated disulfide bond formation in vitro?

Studying dsbB-mediated disulfide bond formation in vitro requires careful attention to redox conditions and protein stability:

  • Buffer Optimization:

ComponentOptimal RangeRationale
pH7.0-8.0Mimics periplasmic environment
NaCl100-200 mMIonic strength stability
Detergent2-3× CMCMembrane protein solubility
Glycerol5-10%Prevents aggregation
  • Redox Cofactor Requirements:

    • Ubiquinone (Q1 or Q8): 10-50 μM

    • Optional molecular oxygen as terminal electron acceptor

    • NADPH/thioredoxin reductase system for recycling

  • Activity Assay Conditions:

    • Temperature: 25-30°C (optimal for Acinetobacter enzymes)

    • Monitor reaction by following:

      • Fluorescence of labeled substrate proteins

      • Oxygen consumption using oxygen electrode

      • Ubiquinone reduction spectrophotometrically

    • Use purified Acinetobacter DsbA as the physiological partner

  • Controls and Validation:

    • Site-directed mutagenesis of active site CXXC motifs as negative controls

    • Competition assays with known DsbB inhibitors

    • Mass spectrometry to confirm disulfide bond formation in substrate proteins

Particular attention should be paid to the redox state of the system throughout experiments, as atmospheric oxygen can cause non-enzymatic oxidation that may confound results.

How can I design a high-throughput screen for inhibitors of Acinetobacter dsbB as potential adjuvants to antibiotic therapy?

Designing a high-throughput screen for Acinetobacter dsbB inhibitors requires balancing throughput with physiological relevance:

  • Primary Assay Design:

    • Enzymatic Activity Screen:

      • Measure reduction of artificial electron acceptors (DCPIP) coupled to dsbB activity

      • Fluorescence-based assay using self-quenching fluorescent peptides that increase signal upon reduction

      • Plate format: 384-well plates with 30-50 μL reaction volume

    • Assay Parameters:

      • Z' factor optimization (aim for >0.7)

      • Signal-to-background ratio >5:1

      • DMSO tolerance testing (typically up to 2%)

  • Compound Library Selection:

    • Diversity-oriented collections for initial screening

    • Focused libraries targeting redox-active compounds

    • Natural product extracts, particularly from soil microorganisms competing with Acinetobacter

  • Secondary Validation Assays:

    • Whole-cell assays measuring disulfide bond formation in vivo

    • Synergy testing with antibiotics against A. baumannii

    • Counter-screens against mammalian disulfide isomerases to ensure selectivity

  • Tertiary Characterization:

    • Mechanism of inhibition (competitive, non-competitive, irreversible)

    • Binding site identification using hydrogen-deuterium exchange mass spectrometry

    • Crystal structure of inhibitor-bound dsbB (if achievable)

  • Physiological Relevance Testing:

    • Evaluation of inhibitor effect on virulence factor maturation

    • Assessment of impact on resistance gene transfer frequency

    • Testing effectiveness against clinical isolates with different resistance profiles

This screening approach could yield valuable adjuvants that sensitize multidrug-resistant A. baumannii to existing antibiotics by compromising the folding of resistance determinants that require disulfide bonds for proper function .

What is the potential of targeting dsbB in Acinetobacter species for developing novel antimicrobial strategies?

Targeting dsbB in Acinetobacter species presents a promising approach for novel antimicrobial development, with several advantages over conventional antibiotics:

  • Pathogen-Specific Vulnerability:

    • DsbB inhibition would primarily affect the folding of secreted virulence factors

    • The disulfide bond formation pathway is critical for bacterial pathogenesis but absent in mammalian cytoplasm

    • Selective pressure on resistance mechanisms may be reduced compared to direct bactericidal agents

  • Anti-Virulence Approach:

    • Rather than killing bacteria directly, dsbB inhibitors would reduce pathogenicity

    • This strategy may reduce the selective pressure driving resistance development

    • Potential for preservation of beneficial microbiota compared to broad-spectrum antibiotics

  • Synergistic Potential:

    • DsbB inhibition could increase susceptibility to existing antibiotics

    • Particularly relevant for A. baumannii, which has developed resistance to most available antibiotics

    • May restore effectiveness of older, less toxic antibiotics

  • Resistance Transfer Disruption:

    • If dsbB function is linked to the Xer recombination system's ability to mobilize resistance genes, inhibitors might reduce horizontal gene transfer

    • This would address A. baumannii's concerning capacity as a "known reservoir of multiple plasmids carrying antibiotic resistance markers"

  • Challenges and Considerations:

    • Membrane protein drug targets typically have lower druggability

    • Penetration of inhibitors into the periplasmic space requires careful medicinal chemistry

    • Potential for bypass mechanisms through alternative folding pathways

The alarming rise of multidrug-resistant A. baumannii, particularly in critical care units, underscores the urgent need for novel therapeutic approaches that this strategy could address .

How can structural data on Acinetobacter dsbB inform structure-based drug design efforts?

Structural data on Acinetobacter dsbB can significantly accelerate structure-based drug design through multiple avenues:

  • Identification of Druggable Pockets:

    • Active site containing CXXC motifs represents the primary target

    • Hydrophobic quinone-binding site offers opportunities for competitive inhibitors

    • Interface with DsbA provides potential for disrupting protein-protein interactions

  • Structure-Activity Relationship Development:

    • Homology models based on E. coli DsbB crystal structures provide starting points

    • Molecular dynamics simulations can reveal transient pockets not visible in static structures

    • Fragment-based screening against structural models can identify initial chemical matter

  • Virtual Screening Approaches:

    • Structure-based virtual screening using docking against defined binding sites

    • Pharmacophore modeling based on known inhibitors or natural substrates

    • Machine learning models trained on structural data to predict binding affinity

  • Rational Design Principles:

    • Design of covalent inhibitors targeting active site cysteines

    • Development of peptidomimetics that compete with DsbA binding

    • Exploration of allosteric inhibitors that lock dsbB in inactive conformations

  • Species Selectivity Considerations:

    • Comparative analysis of dsbB structures across bacterial species can identify Acinetobacter-specific features

    • Focus on regions that differ between A. baumannii and commensal bacteria

    • Potential to design narrow-spectrum agents that minimize disruption of beneficial microbiota

This structure-guided approach is particularly valuable given A. baumannii's status as a serious public health concern worldwide with high mortality rates in hospital settings , highlighting the need for novel therapeutic strategies.

What are the most promising approaches for assessing the in vivo efficacy of dsbB inhibitors against Acinetobacter infections?

Assessing the in vivo efficacy of dsbB inhibitors against Acinetobacter infections requires a comprehensive evaluation strategy:

  • Animal Model Selection and Optimization:

    • Murine Pneumonia Model: Reflects common clinical presentation of A. baumannii infections

    • Wound Infection Models: Relevant for military and trauma settings where A. baumannii is prevalent

    • Galleria mellonella (Wax Moth) Larva Model: Cost-effective preliminary screening tool

  • Efficacy Parameters:

    • Primary Endpoints:

      • Bacterial burden in tissues

      • Survival rates

      • Inflammatory markers (cytokines, neutrophil recruitment)

    • Secondary Endpoints:

      • Antibiotic synergy evaluation

      • Resistance development monitoring

      • Microbiome impact assessment

  • Pharmacokinetic/Pharmacodynamic (PK/PD) Considerations:

    • Determination of minimum effective concentration in relevant tissues

    • Assessment of protein binding effects on efficacy

    • Establishment of PK/PD indices that correlate with efficacy

  • Resistance Development Assessment:

    • Serial passage experiments under inhibitor pressure

    • Whole genome sequencing of resistant isolates

    • Biochemical characterization of resistant dsbB variants

  • Translational Biomarkers:

    • Identification of disulfide-dependent proteins that can serve as pharmacodynamic markers

    • Development of assays to measure inhibitor target engagement in vivo

    • Correlation of biochemical effects with clinical outcomes

This multifaceted approach aligns with the critical need for new therapeutic options against A. baumannii, which has been identified as a serious public health concern worldwide responsible for high mortality, particularly in intensive care units .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.