Recombinant Acinetobacter sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Definition and Production

The Recombinant Acinetobacter sp. MscL is a full-length, His-tagged protein expressed in Escherichia coli (strain Acinetobacter baylyi). It is purified via affinity chromatography and reconstituted into liposomes for functional assays . Key specifications include:

ParameterDetail
UniProt IDQ6FE93
Amino Acid Sequence1-146 residues (MSIIQEFREFAVKGNMIDLAVGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFTQKFVVLGNNPDNLQSLDALQKAGVNVLTYGNFLTILINFIILAWVVFLMVKLINRMRRKQEEAPAAPAPTPEDIALLREIRDELKNRPQV)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for long-term storage

3.1. Osmoregulation and Stress Response

  • Protein Excretion: In E. coli, MscL mediates excretion of cytoplasmic proteins (e.g., eGFP) into the periplasm under hypo-osmotic stress . Knockout strains (ΔmscL) show reduced excretion efficiency, rescued by recombinant MscL .

  • Translational Stress: MscL activity is upregulated during arfA-mediated ribosome stalling, linking mechanosensation to stress adaptation .

3.2. Antimicrobial Targeting

  • Agonist Sensitivity: Small molecules (e.g., 011A) bind near TM1-TM2 interfaces, destabilizing the closed state and potentiating antibiotic entry .

  • Broad-Spectrum Potential: Acinetobacter sp. MscL’s conservation across pathogens makes it a candidate for adjuvant therapies .

Comparative Analysis with Other MscL Homologs

SpeciesAcinetobacter baylyi Brevibacillus brevis Escherichia coli
Length (aa)146154136
TM1 SequenceVVVLGNNPDNLQSLDALQKFINLSGVPYKTIAEAKTAVIGGAFGKIVTSLVND
Expression SystemE. coliE. coliE. coli
Key Mutation SitesL89 (TM pocket)G22, N24 (pore constriction)V23, G26 (gating hinge)

Challenges and Future Directions

  • Structural Dynamics: The open-state structure of MscL remains unresolved, necessitating advanced cryo-EM or EPR studies .

  • Drug Development: High-throughput screens for Acinetobacter-specific MscL agonists could combat multidrug-resistant strains .

  • Biotechnological Use: Engineered MscL variants may enable controlled solute release in synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; ACIAD0704; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
mscL
Target Protein Sequence
MSIIQEFREFAVKGNMIDLAVGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFTQKFV VLGNNPDNLQSLDALQKAGVNVLTYGNFLTILINFIILAWVVFLMVKLINRMRRKQEEAP AAPAPTPEDIALLREIRDELKNRPQV
Uniprot No.

Target Background

Function

A membrane channel activated by stretch forces within the lipid bilayer. It may play a regulatory role in cellular osmotic pressure adjustments.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MscL protein in Acinetobacter species and what is its function?

MscL (Large-conductance mechanosensitive channel) in Acinetobacter functions as an emergency release valve that responds to osmotic pressure changes. These channels open to release cytoplasmic solutes when bacteria face sudden decreases in external osmotic pressure, preventing cell lysis. The MscL channel forms one of the largest gated pores known, capable of passing molecules up to 30 Å in diameter .

Recent studies have revealed additional functions beyond osmotic regulation. The antibiotic streptomycin can open MscL and use it as a primary pathway to enter the bacterial cytoplasm, suggesting MscL plays an unexpected role in antibiotic susceptibility . Acinetobacter sp. K1, in particular, harbors MscL genes that contribute to intracellular regulation of osmotic pressure, enabling adaptation to environmental stresses .

What experimental techniques are commonly used to study mechanosensitive channels in Acinetobacter?

Based on established methodologies for bacterial MscL research, several key techniques are applicable to Acinetobacter MscL studies:

Protein Expression and Purification:

  • Expression as fusion proteins (e.g., with glutathione S-transferase)

  • Purification using affinity chromatography (e.g., glutathione-coated beads)

  • Protein recovery via enzymatic cleavage (e.g., thrombin)

Functional Analysis:

  • Patch-clamp electrophysiology to measure channel conductance

  • Reconstitution of purified proteins into artificial liposomes

  • Osmotic downshock survival assays

Structural and Biochemical Methods:

  • Transmission Fourier transform infrared spectroscopy

  • Circular dichroism (CD) spectroscopy to confirm protein secondary structure

  • PhoA fusion assays to determine membrane topology

Genetic Approaches:

  • Gene deletion (knockout) studies

  • Complementation studies to confirm phenotypes

  • Heterologous expression in other bacterial systems

What is the genetic structure and conservation of the MscL gene in Acinetobacter species?

While detailed information specific to Acinetobacter MscL genetic structure is limited in the search results, several important characteristics can be inferred:

  • The MscL gene is conserved across bacterial species including Acinetobacter

  • Most species contain one highly conserved copy of the MscL gene

  • Acinetobacter sp. K1 genome analysis confirms the presence of the MscL gene

The general structure of bacterial MscL genes suggests Acinetobacter MscL likely encodes a protein with two transmembrane domains (TM1 and TM2), with both N and C termini located in the cytoplasm . The predicted topology aligns with established models from other bacterial species.

Unlike MscS channels, which have multiple paralogues with diverse functions, MscL channels typically maintain a more conserved function across bacterial species. This conservation suggests that findings from better-studied bacterial systems (like E. coli) may be applicable to understanding Acinetobacter MscL function .

How does Acinetobacter MscL compare to other bacterial mechanosensitive channels?

Bacterial mechanosensitive channels fall into two main categories: MscL (large conductance) and MscS (small conductance), with MscL exhibiting:

CharacteristicMscLMscSNotes
Conductance3.6 nS1.0 nSMscL forms a significantly larger pore
Activation thresholdHigherLowerMscL requires greater membrane tension
Genetic diversityLow (typically one conserved copy)High (multiple paralogues)MscS extends into plant kingdom; MscL limited to bacteria and some fungi
Gating mechanismForce-from-lipidForce-from-lipidBoth sense membrane tension directly rather than through tethers
Structural complexitySimplerMore complexMscL has characteristic two-transmembrane domain structure

The MscL channel functions according to the force-from-lipid (FFL) hypothesis, meaning it senses and responds directly to changes in lateral pressures within the membrane without requiring cytoskeletal tethers . This mechanism appears to be conserved across bacterial species including Acinetobacter.

What are the optimal conditions for functional reconstitution of recombinant Acinetobacter MscL in artificial liposomes?

While protocols specific to Acinetobacter MscL reconstitution are not explicitly detailed in the search results, a methodological approach can be derived from established E. coli MscL protocols with appropriate modifications:

Expression and Purification Protocol:

  • Express Acinetobacter MscL as a fusion protein with glutathione S-transferase

  • Purify using glutathione-coated beads

  • Cleave with thrombin to recover the MscL protein

  • Verify protein purity via SDS-PAGE

Reconstitution Parameters:

  • Lipid composition: Critical for function; consider testing multiple compositions as specific lipid requirements vary between homologs (e.g., M. tuberculosis MscL requires phosphatidylinositol)

  • Protein-to-lipid ratio: Typically 1:100 to 1:1000 (w/w) for optimal channel density

  • Reconstitution method: Detergent dialysis or destabilized liposomes

  • Buffer conditions: Physiological ionic strength (~150 mM KCl) and pH 7.2-7.4

Functional Verification:

  • Patch-clamp electrophysiology to confirm channel activity

  • Test pressure sensitivity and conductance properties

  • Verify blockage by known MscL inhibitors like gadolinium

For Acinetobacter baumannii specifically, commercially available recombinant protein (e.g., from GeneBio Systems) may provide a standardized starting material for reconstitution studies .

What experimental designs are most appropriate for studying the role of MscL in Acinetobacter virulence and antibiotic resistance?

Investigating links between MscL function and Acinetobacter pathogenicity requires multifaceted experimental approaches:

Genetic Manipulation Studies:

  • Generate precise MscL knockout mutants using allelic exchange

  • Create complemented strains expressing wild-type MscL

  • Develop site-directed mutants targeting key functional residues

  • Construct reporter fusions to monitor MscL expression under different conditions

Phenotypic Characterization:

  • Antibiotic susceptibility testing: Compare MICs between wild-type and mutant strains, particularly for antibiotics like streptomycin that may utilize MscL for entry

  • Osmotic challenge assays: Assess survival following hypoosmotic shock

  • Biofilm formation: Quantify using crystal violet staining and confocal microscopy

  • Serum resistance assays: Determine if MscL contributes to the high serum resistance observed in clinical Acinetobacter isolates

Infection Models:

  • Cell culture infections to assess adherence and invasion capabilities

  • Galleria mellonella model for preliminary virulence assessment

  • Murine pneumonia or bacteremia models for comprehensive virulence studies

Expression Analysis:

  • qRT-PCR to measure MscL expression under different conditions

  • RNA-seq to identify gene networks affected by MscL function

  • Proteomics to detect changes in membrane protein composition

This experimental framework would help determine if MscL contributes to the remarkable adaptability and antibiotic resistance of clinical Acinetobacter isolates, particularly carbapenem-resistant A. baumannii which poses significant healthcare challenges .

How can researchers address data inconsistencies in electrophysiological studies of Acinetobacter MscL channels?

Electrophysiological studies of mechanosensitive channels present unique challenges that can lead to data inconsistencies. Researchers studying Acinetobacter MscL should implement rigorous protocols to address potential variability:

Sources of Inconsistency and Mitigation Strategies:

Source of InconsistencyMitigation Strategy
Membrane tension variabilityStandardize patch preparation and pressure application techniques; use calibrated pressure-clamp systems
Lipid composition effectsMaintain consistent lipid preparations; document exact compositions; test multiple formulations
Protein conformational heterogeneityOptimize purification protocols; verify proper folding using spectroscopic methods
Recording conditionsStandardize buffer compositions, temperature, and patch-clamp parameters
Data analysis variationsEstablish clear criteria for channel identification and event classification

Quality Control Procedures:

  • Include positive controls (e.g., well-characterized E. coli MscL) in experimental designs

  • Perform multiple technical and biological replicates

  • Use statistical approaches to identify and address outliers

  • Compare results across different experimental systems (purified protein vs. native membranes)

Documentation Standards:

  • Maintain comprehensive records of experimental conditions

  • Report all relevant parameters in publications

  • Share raw data through appropriate repositories

  • Document software settings used for analysis

When inconsistencies occur, systematic troubleshooting through a structured experimental design approach can help identify sources of variability .

How does the structural data from MscL channels inform potential drug targeting strategies against multidrug-resistant Acinetobacter strains?

The structural characteristics of MscL channels present unique opportunities for therapeutic targeting of multidrug-resistant Acinetobacter:

Structural Features with Therapeutic Potential:

  • Large pore diameter (up to 30 Å when open) provides potential entry route for antibiotics

  • Conserved transmembrane domains offer binding sites for small molecules

  • Gating mechanism sensitive to membrane properties that could be pharmacologically manipulated

  • Accessibility from the extracellular environment

Potential Targeting Strategies:

  • Channel Agonists: Developing compounds that trigger inappropriate MscL opening, disrupting osmotic balance and cellular homeostasis

  • Trojan Horse Approach: Using MscL as a pathway for entry of otherwise excluded antibiotics

  • Functional Blockers: Designing molecules that prevent MscL from properly responding to osmotic stress

  • Combination Therapies: Pairing MscL-targeting compounds with conventional antibiotics to enhance efficacy

Translational Research Directions:

  • High-throughput screening of compound libraries against recombinant Acinetobacter MscL

  • Structure-based drug design utilizing crystallographic data from homologous channels

  • Testing candidate compounds against clinical isolates with varying resistance profiles

  • Developing nanocarriers that interact specifically with MscL channels

This approach is particularly relevant for carbapenem-resistant Acinetobacter baumannii (CRAb), which has been designated as a pathogen of urgent concern by the CDC with limited treatment options .

What approaches can be used to study the interaction between MscL function and biofilm formation in Acinetobacter species?

Biofilm formation is a key virulence factor in Acinetobacter infections, particularly in healthcare settings. Investigating potential links between MscL function and biofilm development requires specialized methodological approaches:

Comparative Analysis Methods:

  • Genetic approach: Compare wild-type strains with isogenic MscL knockout mutants and complemented strains

  • Temporal studies: Examine biofilm development over time with MscL function blocked or enhanced

  • Environmental variation: Test biofilm formation under different osmotic conditions that would affect MscL activation

Biofilm Characterization Techniques:

  • Quantitative assays:

    • Crystal violet staining for biomass quantification

    • MTT/XTT assays for metabolic activity

    • Colony forming unit (CFU) enumeration for viable cells

  • Structural analysis:

    • Confocal laser scanning microscopy with fluorescent reporters

    • Scanning electron microscopy for detailed surface architecture

    • Atomic force microscopy for mechanical properties

  • Molecular approaches:

    • Transcriptomic profiling of biofilm vs. planktonic cells

    • Proteomics to identify membrane protein changes

    • Reporter gene fusions to monitor gene expression in situ

Relevant Research Questions:

  • Does osmotic stress sensing through MscL influence initial attachment to surfaces?

  • Is MscL activity altered within biofilm microenvironments?

  • How does MscL function affect extracellular polymeric substance (EPS) production?

  • Can targeting MscL disrupt established Acinetobacter biofilms?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.