Recombinant Acinetobacter sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

LspA processes prolipoproteins by cleaving the N-terminal signal peptide after the conserved lipobox motif (typically L-A/S-G-C). This step is essential for:

  • Maturation of lipoproteins critical for cell envelope integrity .

  • Proper localization of lipoproteins to the inner or outer membrane .

  • Maintenance of membrane permeability and resistance to serum-mediated lysis .

In A. baumannii, LspA activity is inhibited by cyclic depsipeptides like globomycin and its analogs (e.g., G5132), which block signal peptide cleavage, leading to lethal accumulation of unprocessed prolipoproteins .

Key Inhibitors

CompoundTargetMIC Against A. baumannii (μg/mL)Resistance Mechanism
GlobomycinLspA>64 (wild-type strains) Poor outer membrane penetration
G5132 (analog)LspA4–8 (wild-type strains) Mutations in lirL signal peptide

Findings

  • G5132, a synthetic globomycin analog, exhibits 8–10× greater potency than globomycin against A. baumannii due to improved membrane permeability .

  • Resistance to G5132 maps to mutations in the signal peptide of lirL, a highly abundant lipoprotein. These mutations reduce LspA’s substrate sensitivity, enabling bacterial survival despite partial inhibition .

Resistance Mechanisms

Mutations in lirL (prolipoprotein signal peptidase inhibitor resistance lipoprotein) confer resistance to LspA inhibitors:

  • Common Mutations: Insertions (e.g., FAVAA, AAV) or deletions in the lirL signal peptide region .

  • Consequences:

    • Accumulation of diacylglyceryl-modified LirL prolipoprotein .

    • Attenuated virulence and impaired cell division .

    • Increased serum sensitivity due to defective lipoprotein trafficking .

Experimental Applications

Recombinant LspA is used in SDS-PAGE gel-shift assays to evaluate inhibitor efficacy:

  1. Assay Workflow:

    • Recombinant prepro inhibitor of cysteine protease (ppICP) is lipidated by diacylglyceryl transferase (Lgt).

    • LspA cleaves ppICP, producing a ~10 kDa smaller product (DA-ICP) .

    • Inhibitor potency is quantified by reduced DA-ICP signal intensity .

  2. Key Results:

    • Cyclic peptides G2a and G2d showed specific LspA inhibition in vitro .

    • These inhibitors reduced growth of multidrug-resistant A. baumannii strains by >90% at 32 μg/mL .

Therapeutic Implications

Targeting LspA in A. baumannii offers advantages:

  • Essentiality: LspA is indispensable for bacterial viability .

  • Synergy: Combining LspA inhibitors with β-lactams or polymyxins could overcome resistance .

  • Virulence Impact: lirL deletion strains show attenuated virulence in infection models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag if possible.
Synonyms
lspA; ACIAD0021; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
lspA
Target Protein Sequence
MPKLEAKKGLFQFYPHNLIWLGLSILAIIIDQWTKWIASTHLNYADPVPVLPFLNWTLLH NYGAAFSFLSDAGGWQHYLFTGLAGIVSIIFIFWLMRMPKNAMILPAAIALILGGALGNL IDRMTLGYVVDFIHIYYQNHHFPAFNIADSAITIGTILLLIDTFFLEKQRIQRAEVKHD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what role does it play in bacterial physiology?

Lipoprotein signal peptidase (LspA), also known as SPaseII, is an essential aspartic acid protease with a pivotal role in bacterial lipoprotein maturation. It functions within the bacterial lipoprotein biosynthesis pathway, which is critical for envelope biogenesis in gram-negative bacteria like Acinetobacter baumannii. LspA recognizes a region of the signal sequence within the prolipoprotein termed the "lipobox" and removes all residues N-terminal to a post-translationally modified diacylglyceryl (DAG)-cysteine residue . Recent structural studies, such as the X-ray structure of Lsp from Pseudomonas aeruginosa, have revealed that LspA is a monomeric protein consisting of four transmembrane helices with an active site that lies within the lipid bilayer .

Bacterial lipoproteins that undergo processing by LspA have diverse and important roles, including nutrient uptake, adhesion, sporulation, protein transport, secretion, cell wall biosynthesis, and antibiotic resistance . This makes LspA an attractive target for antibiotic development, especially against multidrug-resistant pathogens like Acinetobacter baumannii.

How does the lipoprotein maturation pathway function in Acinetobacter sp. compared to other bacteria?

Bacterial lipoprotein biosynthesis is a multistep pathway that begins with the translation of a preprolipoprotein containing a signal peptide followed by a conserved four-amino acid sequence called the lipobox ([LVI][ASTVI][GAS]C) . In Acinetobacter baumannii, as in other gram-negative bacteria, after translation, the preprolipoprotein is secreted through the inner membrane via the Sec or Tat pathways, followed by sequential modification by three enzymes: Lgt, LspA, and Lnt .

  • A. baumannii lacks a homologous lpp gene, which encodes the Braun's lipoprotein in E. coli .

  • Some A. baumannii strains (AB5075 and AB19606) encode two lspA genes: the essential lspA gene flanked by ileS and fkpB (as in E. coli), and a second lspA ortholog .

  • The mechanisms of resistance to LspA inhibitors differ between A. baumannii and E. coli. In E. coli, lpp deletion and decreased expression are major mechanisms of resistance to inhibitors of LspA, whereas in A. baumannii, mutations in the signal peptide of a specific lipoprotein (LirL) confer resistance .

These differences contribute to the substantially lower potency of LspA inhibitors against A. baumannii compared to E. coli, highlighting the importance of species-specific research on lipoprotein processing.

What is the significance of LirL in Acinetobacter baumannii's response to LspA inhibitors?

LirL (LspA inhibitor resistance lipoprotein) is a previously uncharacterized, highly abundant alanine-rich lipoprotein in Acinetobacter baumannii that plays a critical role in resistance to LspA inhibitors . Research has shown that deletion of lirL confers resistance to inhibitors of type II signal peptidase, such as the globomycin analog G5132 .

Mutations leading to G5132 resistance in A. baumannii map to the signal peptide of the lirL gene. These signal peptide mutations result in the accumulation of diacylglyceryl-modified LirL prolipoprotein in untreated cells without significant loss in cell viability, suggesting that these mutations overcome a block in lipoprotein biosynthetic flux by decreasing LirL prolipoprotein substrate sensitivity to processing by LspA .

Beyond its role in antibiotic resistance, deletion of lirL leads to several phenotypic changes in A. baumannii:

  • Inefficient cell division

  • Increased sensitivity to serum

  • Attenuated virulence

This suggests that LirL may have additional physiological functions beyond its role in resistance to LspA inhibitors, making it an important target for further study in the context of A. baumannii pathogenesis.

How has the development of G5132 advanced our understanding of LspA inhibition in Acinetobacter baumannii?

G5132, a potent globomycin analog, has significantly advanced our understanding of LspA inhibition in A. baumannii. Prior to G5132, the natural product globomycin (which inhibits LspA) was ineffective against wild-type A. baumannii clinical isolates due to poor penetration through the outer membrane .

Key advancements from G5132 research include:

  • Improved potency: G5132 showed a >8-fold reduced minimal inhibitory concentration (MIC) against wild-type A. baumannii strains Ab17978 and Ab19606 compared to globomycin. It also demonstrated >10-fold reduced MIC against E. coli, Enterobacter cloaceae, and K. pneumoniae strains .

  • Facilitated resistance studies: The increased potency of G5132 against wild-type A. baumannii enabled researchers to examine resistance mechanisms to LspA inhibitors. This led to the identification of LirL as a key factor in resistance .

  • Strain-specific differences: Research with G5132 revealed significant differences in frequency of resistance (FOR) between A. baumannii strains. Ab19606 and AB5075 strains showed >5,000-fold higher FOR compared with Ab17978, which itself had a lower FOR than E. coli and K. pneumoniae .

  • Genomic insights: The varying susceptibility to G5132 led to the discovery that some A. baumannii strains (AB5075 and AB19606) possess two lspA genes, potentially explaining their different resistance profiles .

These findings validate lipoprotein biosynthesis as an antibacterial target in A. baumannii and provide crucial insights for the development of next-generation LspA inhibitors.

What are the optimal methods for expressing and purifying recombinant Acinetobacter sp. LspA for biochemical studies?

Expression and purification of recombinant Acinetobacter sp. LspA presents unique challenges due to its membrane-embedded nature. Based on current research methodologies, the following approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) with pET expression vectors containing the Acinetobacter sp. lspA gene has proven effective

  • The addition of a C-terminal His6-tag facilitates purification while maintaining enzymatic activity

  • Expression should be induced at lower temperatures (16-20°C) to enhance proper folding of membrane proteins

Membrane Preparation and Solubilization:

  • Cells should be lysed via French press or sonication in buffer containing protease inhibitors

  • Membrane fractions should be isolated through differential centrifugation

  • n-dodecyl β-D-maltoside (DDM) has been successfully used for membrane protein solubilization at concentrations of 1-2%

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates and contaminants

  • Maintenance of detergent above critical micelle concentration throughout purification

Activity Preservation:

  • Storage buffer should include 0.05% DDM to maintain the protein in its native conformation

  • Addition of glycerol (10-20%) can improve stability during storage

  • Storage at -80°C in small aliquots to minimize freeze-thaw cycles

While these methods are derived from successful membrane protein purification approaches, researchers should optimize conditions specifically for Acinetobacter sp. LspA, as membrane protein behavior can vary considerably between different bacterial species.

How can FRET-based assays be optimized for studying LspA activity and substrate specificity?

FRET (Förster Resonance Energy Transfer) reporters have proven valuable for studying LspA activity and substrate specificity. Based on recent research, the following optimization strategies are recommended:

Peptide Design Considerations:

  • Synthetic peptide-based FRET reporters should mimic the natural lipobox sequence ([LVI][ASTVI][GAS]C) found in Acinetobacter sp. lipoproteins

  • The optimal lipid length for the diacylglyceryl modification has been identified as didecanoyl glycerol

  • Exclusive enantio-selectivity for the (R)-form of the diacylglycerol has been demonstrated, suggesting this should be incorporated into substrate design

Fluorophore Selection:

  • FRET pairs with suitable spectral properties that work efficiently in membrane environments should be prioritized

  • Common pairs include EDANS/DABCYL or fluorescein/tetramethylrhodamine

  • Placement of the donor and acceptor should minimize interference with substrate recognition

Assay Buffer Optimization:

  • Detergent concentration must be carefully controlled to maintain LspA activity while solubilizing the lipidated substrate

  • Inclusion of phospholipids can help create a more native-like environment for the membrane-embedded enzyme

  • Buffer pH optimization is critical, as LspA is an aspartic acid protease with pH-dependent activity

Data Analysis:

  • Initial velocity measurements should be used to determine kinetic parameters

  • Michaelis-Menten analysis can provide valuable insights into substrate preferences

  • Competitive inhibition studies with substrate analogs can map the substrate binding pocket

By systematically optimizing these parameters, researchers can develop robust FRET-based assays that accurately measure LspA activity and provide insights into substrate specificity across different bacterial species, including Acinetobacter sp.

How do we reconcile differences in LspA inhibitor efficacy between Acinetobacter species and other gram-negative bacteria?

Resolving the disparities in LspA inhibitor efficacy between Acinetobacter species and other gram-negative bacteria requires addressing several key factors:

Structural and Functional Differences:

  • LspA from Acinetobacter sp. may have subtle structural differences in the active site compared to Enterobacteriaceae LspA enzymes

  • The absence of an Lpp homolog in A. baumannii significantly alters the consequences of LspA inhibition, as Lpp mislocalization is a major mechanism of cell death in E. coli

  • The presence of two lspA genes in some A. baumannii strains (AB5075 and AB19606) likely contributes to inhibitor efficacy differences

Permeability Barriers:

  • The natural product globomycin has poor penetration through the outer membrane of wild-type A. baumannii clinical isolates

  • Enhanced analogs like G5132 show improved potency against A. baumannii, suggesting that permeability is a critical factor

  • Systematic studies combining permeability measurements with inhibitor binding affinity determinations would help clarify these differences

Resistance Mechanisms:

  • In E. coli, lpp deletion and decreased expression are major mechanisms of resistance to LspA inhibitors

  • In A. baumannii, mutations in the signal peptide of lirL or deletion of lirL confer resistance

  • Comparative genomic and proteomic analyses of lipoprotein profiles across species could help identify additional factors influencing inhibitor efficacy

Methodological Approach to Resolve Contradictions:

  • Perform direct comparison of purified LspA enzymes from multiple species using standardized substrates and assay conditions

  • Use lipidomic analyses to characterize differences in membrane composition that might affect inhibitor access

  • Develop isogenic strains with defined genetic modifications to isolate specific factors contributing to inhibitor efficacy differences

  • Apply molecular dynamics simulations to predict species-specific inhibitor interactions

By addressing these factors through a multidisciplinary approach, researchers can better understand the basis for species-specific differences in LspA inhibitor efficacy and develop improved inhibitors with broader spectrum activity.

What are the contradictions in our understanding of LspA substrate recognition across different bacterial species?

Several contradictions exist in our current understanding of LspA substrate recognition across bacterial species, which require systematic investigation to resolve:

Lipobox Sequence Variations:

  • The canonical lipobox motif ([LVI][ASTVI][GAS]C) is generally conserved across species, but subtle variations exist

  • It remains unclear whether these variations have evolved to match species-specific LspA recognition preferences

  • Comprehensive mutagenesis studies of the lipobox sequence in different bacterial species would help clarify these differences

Lipid Requirements:

Signal Peptide Recognition Beyond the Lipobox:

  • Mutations in the signal peptide of lirL in A. baumannii can confer resistance to LspA inhibitors by decreasing substrate sensitivity to processing

  • This suggests that regions outside the lipobox influence substrate recognition

  • The extent of this influence may vary between bacterial species, creating contradictions in substrate preference studies

Signal Peptide Length Effects:

  • Signal peptide length varies considerably among bacterial lipoproteins (typically 15-30 amino acids)

  • The impact of this variation on LspA processing efficiency is not consistently understood across bacterial species

  • Different experimental approaches (in vivo vs. in vitro) have yielded contradictory results on the importance of signal peptide length

Methodological Approach to Address Contradictions:

  • Develop standardized substrate libraries that systematically vary lipobox sequence, lipid modification, signal peptide length, and composition

  • Perform comparative kinetic analyses of LspA enzymes from multiple bacterial species using these standardized substrates

  • Use structural biology approaches to capture species-specific LspA-substrate complexes

  • Apply bioinformatic analyses of natural lipoprotein substrates across species to identify patterns that may explain recognition preferences

Resolving these contradictions would significantly advance our understanding of bacterial lipoprotein processing and facilitate the development of species-specific or broad-spectrum LspA inhibitors.

How can recombinant LspA be utilized in high-throughput screening for novel antimicrobial compounds?

Recombinant Acinetobacter sp. LspA offers a valuable platform for high-throughput screening (HTS) of novel antimicrobial compounds. The following methodological approach is recommended for establishing an effective screening system:

Assay Development:

  • FRET-based assays using optimized substrate reporters provide a quantitative readout suitable for HTS formats

  • Signal-to-noise ratio can be maximized by using substrates with didecanoyl glycerol modification and the (R)-form of diacylglycerol, which have been identified as optimal for LspA activity

  • Positive controls should include known LspA inhibitors like globomycin and G5132

Screening Format Optimization:

  • Miniaturization to 384- or 1536-well formats can enhance throughput while reducing reagent consumption

  • Time-resolved fluorescence measurements can minimize interference from compound autofluorescence

  • Counterscreening against purified aspartic proteases can identify LspA-selective inhibitors

Compound Library Selection:

  • Natural product libraries are promising, as existing LspA inhibitors like globomycin are natural products

  • Diversity-oriented synthetic libraries can explore chemical space beyond known inhibitor scaffolds

  • Fragment-based approaches can identify novel binding modes to the LspA active site

Hit Validation Cascade:

  • Confirmation of hits in dose-response format using the primary assay

  • Secondary biochemical assays with purified LspA from multiple bacterial species to assess spectrum of activity

  • Whole-cell antimicrobial testing against Acinetobacter sp. and other priority pathogens

  • Target engagement studies (e.g., cellular thermal shift assays) to confirm mechanism of action

  • Resistance mechanism investigations focusing on lirL mutations or deletions

Data Analysis Framework:

  • Machine learning approaches can identify structure-activity relationships to guide hit optimization

  • Integration with structural information about LspA can facilitate rational design of improved inhibitors

  • Pharmacophore modeling based on confirmed hits can expand the chemical diversity of lead compounds

This comprehensive approach to HTS with recombinant Acinetobacter sp. LspA provides a pathway for identifying novel antimicrobial compounds targeting an essential pathway in gram-negative bacteria, potentially addressing the urgent need for new antibiotics against multidrug-resistant pathogens.

What is the potential role of LspA inhibition in modulating Acinetobacter sp. virulence and immune response?

LspA inhibition has significant potential for modulating Acinetobacter sp. virulence and immune responses, as evidenced by recent research findings:

Impact on Bacterial Physiology and Virulence:

  • Deletion of lirL, a key lipoprotein processed by LspA, leads to inefficient cell division, increased sensitivity to serum, and attenuated virulence in A. baumannii

  • This suggests that disruption of the lipoprotein processing pathway through LspA inhibition could reduce bacterial pathogenicity

  • Lipoproteins in Acinetobacter sp. play essential roles in adhesion, antibiotic resistance, virulence, invasion, and immune evasion

Immunomodulatory Effects:

  • A. baumannii secretes bioactive lipids that trigger immune signaling through TLR2 activation

  • Culture filtrate from A. baumannii activates NF-κB in macrophages, leading to the production of inflammatory cytokines such as IL-1β, IL-6, and TNFα

  • Lipase treatment of culture filtrate reduces this inflammatory response, suggesting that lipidated components (potentially processed by LspA) are involved in immune activation

Experimental Data on Immune Response:
Treatment of THP1 macrophages with A. baumannii culture filtrate resulted in:

  • Phosphorylation of NF-κB p65

  • Production of pro and mature forms of IL-1β

  • Secretion of IL-6

  • Expression of TNFα

These effects were significantly reduced by lipase treatment, indicating that lipidated components are important immunostimulatory factors .

Potential Therapeutic Applications:

  • Development of LspA inhibitors that reduce virulence without directly killing bacteria, potentially reducing selective pressure for resistance

  • Combination therapies coupling LspA inhibitors with conventional antibiotics to enhance efficacy

  • Immunomodulatory approaches targeting the specific inflammatory pathways activated by Acinetobacter lipoproteins

  • Vaccine development using modified lipoproteins processed by LspA as antigens

Future research should focus on:

  • Characterizing the full spectrum of lipoproteins affected by LspA inhibition in Acinetobacter sp.

  • Determining how these changes specifically impact virulence in animal models

  • Investigating the consequences of LspA inhibition on host-pathogen interactions

  • Assessing whether sub-inhibitory concentrations of LspA inhibitors can effectively attenuate virulence without selecting for resistance

This research direction represents a promising approach to addressing Acinetobacter infections through targeting virulence rather than bacterial growth, potentially offering new therapeutic strategies against this challenging pathogen.

What are the critical factors in designing in vitro assays to accurately measure LspA activity?

Designing robust in vitro assays for Acinetobacter sp. LspA activity requires careful consideration of several critical factors:

Substrate Design and Preparation:

  • Synthetic peptide substrates should incorporate the specific lipobox motif ([LVI][ASTVI][GAS]C) present in Acinetobacter lipoproteins

  • The diacylglyceryl modification should utilize didecanoyl glycerol in the (R)-configuration, which has been identified as optimal for LspA activity

  • Substrate solubility must be maintained without disrupting enzyme function, typically requiring careful detergent optimization

Enzyme Preparation:

  • Recombinant LspA should be purified with minimal detergent (e.g., n-dodecyl β-D-maltoside) to maintain native conformation

  • Protein purity should be >95% to avoid interference from contaminating proteases

  • Enzyme concentration should be carefully calibrated to ensure initial rate conditions

Assay Buffer Composition:

  • pH optimization is critical, as LspA is an aspartic acid protease with pH-dependent activity

  • Inclusion of phospholipids can provide a more native-like environment for the membrane-embedded enzyme

  • Divalent cations may influence activity and should be systematically tested

  • Detergent concentration must be carefully controlled to solubilize substrates while maintaining enzyme activity

Detection Methods:

  • FRET-based detection offers high sensitivity and real-time measurement capabilities

  • Mass spectrometry can provide absolute verification of cleavage site specificity

  • Radiometric assays using labeled substrates can offer high sensitivity but present handling challenges

Control Reactions:

  • Heat-inactivated enzyme controls should be included to account for non-enzymatic substrate degradation

  • Known inhibitors (globomycin, G5132) should be used as positive controls for inhibition studies

  • Substrate specificity controls using altered lipobox sequences can confirm assay specificity

Data Analysis Framework:

  • Initial velocity measurements under conditions of <10% substrate conversion ensure valid kinetic analysis

  • Michaelis-Menten parameters (KM, kcat) should be determined to characterize substrate preferences

  • Hill plots can identify potential cooperative binding effects

By systematically optimizing these factors, researchers can develop reliable in vitro assays that accurately measure LspA activity, enabling detailed characterization of substrate specificity and inhibitor potency for Acinetobacter sp. LspA.

How should researchers interpret differences in frequency of resistance (FOR) to LspA inhibitors between Acinetobacter strains?

Interpreting differences in frequency of resistance (FOR) to LspA inhibitors between Acinetobacter strains requires a systematic analytical approach:

Observed Strain Differences:
Research with the globomycin analog G5132 has revealed substantial differences in FOR between Acinetobacter strains:

  • Ab19606 and AB5075 strains showed >5,000-fold higher FOR compared to Ab17978

  • The FOR for Ab17978 was lower than that observed in E. coli and K. pneumoniae

Key Analytical Considerations:

  • Genetic Basis Analysis:

    • The presence of two lspA genes in AB5075 and AB19606 (versus one in other strains) likely contributes to their higher FOR

    • Whole genome sequencing of resistant isolates should be performed to identify consistent mutational patterns

    • Comparison of lirL sequences across strains may reveal pre-existing polymorphisms that influence resistance potential

  • Resistance Mechanism Characterization:

    • Mutations in the signal peptide of lirL represent a primary resistance mechanism

    • The frequency of these mutations may vary between strains due to differences in DNA repair mechanisms or natural mutation rates

    • Competition experiments between parent and resistant strains can quantify fitness costs associated with resistance

  • Physiological Interpretation:

    • Higher FOR values suggest more available pathways to resistance or lower fitness costs of resistance mutations

    • Lower FOR values indicate fewer resistance options or higher fitness costs

    • Correlation of FOR with virulence, growth rates, and other phenotypic characteristics can provide insights into the biological consequences of resistance

  • Methodological Standardization:

    • FOR determinations should use consistent protocols for all strains (inoculum size, selection conditions, etc.)

    • Multiple independent experiments should be performed to establish statistical significance

    • Resistance should be confirmed through secondary assays (MIC determination, growth curve analysis)

  • Translational Implications:

    • Strains with higher FOR might represent greater clinical challenges for LspA inhibitor therapy

    • Understanding strain-specific resistance patterns can inform therapeutic strategies

    • Combination therapy approaches may be necessary for strains with high FOR

Interpretive Framework:

FOR CategoryRange (relative to Ab17978)InterpretationClinical Implication
Low<1xLimited resistance pathwaysFavorable target for LspA inhibitor therapy
Moderate1-100xMultiple resistance mechanismsMay require higher doses or combination therapy
High>100xExtensive resistance capacityMay not be suitable for LspA inhibitor monotherapy
Very High>1000xIntrinsic resistance potentialAlternative targets should be considered

By applying this analytical framework to FOR data, researchers can gain valuable insights into strain-specific resistance mechanisms, inform preclinical development of LspA inhibitors, and develop more effective therapeutic strategies against multidrug-resistant Acinetobacter infections.

What genomic approaches could advance our understanding of lipoprotein processing in Acinetobacter species?

Advanced genomic approaches offer powerful tools to expand our understanding of lipoprotein processing in Acinetobacter species:

Comparative Genomics:

  • Systematic analysis of lspA gene distribution and evolution across Acinetobacter species and strains

  • Identification of strain-specific variants, such as the second lspA ortholog found in strains AB5075 and AB19606

  • Mapping of lipoprotein encoding genes and their signal sequences to identify species-specific patterns in lipobox motifs

Functional Genomics:

  • Genome-wide CRISPR interference (CRISPRi) screens to identify genes that synthetically interact with lspA

  • Transposon sequencing (Tn-seq) under LspA inhibitor stress to identify genes that modulate sensitivity

  • RNA-seq analysis to characterize transcriptional responses to LspA inhibition across different Acinetobacter strains

Metagenomics and Population Genomics:

  • Analysis of lspA and lipoprotein gene diversity in clinical isolates to identify correlations with antibiotic resistance

  • Investigation of horizontal gene transfer events that may have shaped lipoprotein processing systems

  • Examination of lirL variants in clinical populations to predict resistance potential to LspA inhibitors

Structural Genomics:

  • Homology modeling of Acinetobacter LspA variants based on available structural data

  • Identification of species-specific features that may influence inhibitor binding

  • Prediction of substrate interactions based on co-evolutionary analysis of LspA and its lipoprotein substrates

Methodological Approach:

  • Generate a comprehensive database of Acinetobacter sp. lipoproteomes using signal sequence prediction algorithms

  • Develop machine learning models to predict LspA substrate preference based on signal sequence features

  • Apply genome editing tools to systematically alter lipoprotein signal sequences and measure effects on processing

  • Integrate genomic data with proteomics to validate predicted lipoproteins and their processing

Expected Outcomes:

  • Identification of species-specific features of lipoprotein processing that could be exploited for targeted inhibition

  • Discovery of novel lipoproteins involved in virulence or resistance mechanisms

  • Improved prediction of resistance potential to LspA inhibitors across Acinetobacter species

  • Development of genomic biomarkers for susceptibility to lipoprotein processing inhibitors

These genomic approaches would significantly advance our understanding of lipoprotein processing in Acinetobacter species and potentially identify new therapeutic targets or strategies for combating multidrug-resistant infections.

How might structural biology approaches enhance the development of species-specific LspA inhibitors?

Structural biology approaches offer significant potential for developing species-specific LspA inhibitors targeting Acinetobacter sp.:

Current Structural Knowledge:

  • The X-ray structure of Lsp from Pseudomonas aeruginosa has shown that Lsp is a monomeric protein with four transmembrane helices and an active site within the lipid bilayer

  • This provides a foundation for understanding general LspA architecture, but species-specific features of Acinetobacter LspA remain to be characterized

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (cryo-EM):

    • Determination of high-resolution structures of Acinetobacter sp. LspA in native membrane environments

    • Visualization of LspA-substrate complexes to understand recognition mechanisms

    • Characterization of conformational changes during catalysis

  • X-ray Crystallography:

    • Co-crystallization of LspA with inhibitors like G5132 to reveal binding modes

    • Comparison of Acinetobacter LspA structures with those from other bacterial species to identify unique features

    • Structure determination of resistant LspA variants to understand the molecular basis of resistance

  • NMR Spectroscopy:

    • Dynamic studies of LspA-substrate interactions in membrane mimetics

    • Characterization of conformational changes induced by inhibitor binding

    • Identification of allosteric sites that could be targeted for Acinetobacter-specific inhibition

  • Computational Structural Biology:

    • Molecular dynamics simulations of LspA in native-like membranes

    • Virtual screening of compound libraries against Acinetobacter-specific binding pockets

    • Free energy calculations to predict binding affinities of potential inhibitors

Integration with Biochemical Data:

  • Combining structural insights with substrate specificity data from FRET-based assays

  • Correlation of structural features with resistance mechanisms, particularly those involving lirL

  • Structure-guided mutagenesis to validate key residues in substrate recognition and inhibitor binding

Inhibitor Design Strategy:
The following design framework can be derived from structural biology insights:

Design ElementApproachExpected Benefit
Active site targetingStructure-based design of transition state analogsHigh potency through direct interference with catalysis
Species-specific pocketsFragment-based screening against unique binding sitesEnhanced selectivity for Acinetobacter LspA
Membrane penetrationOptimization of physicochemical properties based on membrane interaction dataImproved access to the membrane-embedded active site
Resistance circumventionDesign of inhibitors that maintain activity against lirL mutantsReduced potential for resistance development

By implementing these structural biology approaches, researchers can develop a detailed understanding of Acinetobacter sp. LspA structure and function, enabling the rational design of species-specific inhibitors with improved potency, selectivity, and resistance profiles. This could lead to new therapeutic options for multidrug-resistant Acinetobacter infections.

What are the most promising therapeutic applications of LspA inhibition in Acinetobacter species?

LspA inhibition represents a promising therapeutic strategy against Acinetobacter species, with several potential applications emerging from recent research:

The development of potent LspA inhibitors like G5132, which shows significantly improved activity against wild-type and clinical A. baumannii isolates compared to globomycin, validates lipoprotein biosynthesis as a viable antibacterial target . This approach is particularly valuable given the urgent need for novel antibacterial therapies against A. baumannii, which has high rates of emerging resistance worldwide .

The most promising therapeutic applications include:

  • Targeted Monotherapy: LspA inhibitors could serve as standalone treatments for Acinetobacter infections, particularly for strains with lower frequency of resistance such as Ab17978 . The essential nature of the lipoprotein biosynthesis pathway makes it an attractive target that is distinct from conventional antibiotic mechanisms.

  • Combination Therapy Approaches: LspA inhibitors could be combined with existing antibiotics to create synergistic effects. Since lipoprotein processing affects membrane integrity and permeability, such combinations might enhance the efficacy of other antibiotics by facilitating their entry into bacterial cells.

  • Anti-virulence Strategy: LspA inhibition affects virulence factors without necessarily killing bacteria outright. The finding that deletion of lirL leads to increased sensitivity to serum and attenuated virulence suggests that LspA inhibitors could reduce pathogenicity even at sub-lethal concentrations . This approach might apply less selective pressure for resistance development.

  • Immunomodulatory Applications: A. baumannii secretes bioactive lipids that trigger immune signaling through TLR2 activation . Modulating this response through controlled LspA inhibition could potentially help balance the host immune response during infection.

  • Prevention of Biofilm Formation: Bacterial lipoproteins often play roles in adhesion and biofilm formation. LspA inhibitors might disrupt these processes, reducing the ability of Acinetobacter to form treatment-resistant biofilms on medical devices and implants.

The identification of specific resistance mechanisms, particularly mutations in the signal peptide of lirL, provides valuable information for designing next-generation inhibitors that maintain efficacy against resistant strains . This knowledge, combined with ongoing structural and biochemical studies of LspA, positions lipoprotein biosynthesis inhibition as one of the most promising novel therapeutic approaches against multidrug-resistant Acinetobacter infections.

What key questions remain unanswered in the field of Acinetobacter sp. lipoprotein signal peptidase research?

Despite significant advances in understanding Acinetobacter sp. lipoprotein signal peptidase, several critical questions remain unanswered:

Fundamental Biochemistry and Structure:

  • What are the structural differences between LspA enzymes from different Acinetobacter species compared to well-studied organisms like E. coli?

  • How do the kinetic parameters of Acinetobacter LspA differ across diverse lipoprotein substrates, and what determines substrate preference?

  • What is the functional significance of the second lspA gene found in some A. baumannii strains (AB5075 and AB19606) , and does it contribute to inhibitor resistance?

Resistance Mechanisms:

  • Beyond mutations in lirL, what other mechanisms might confer resistance to LspA inhibitors in Acinetobacter sp.?

  • What is the molecular basis for the >5,000-fold higher frequency of resistance in Ab19606 and AB5075 compared to Ab17978 ?

  • How do the fitness costs of resistance mutations in lirL affect bacterial survival in clinical settings?

Physiological Roles:

  • What is the complete repertoire of lipoproteins processed by LspA in Acinetobacter sp., and which are essential for viability?

  • How does LspA inhibition affect the bacterial cell envelope and its interaction with host immune components?

  • What is the specific function of LirL that makes its proper processing so critical for Acinetobacter physiology and virulence ?

Therapeutic Development:

  • Can species-specific LspA inhibitors be developed that selectively target Acinetobacter sp. over commensal bacteria?

  • What pharmacokinetic properties are required for LspA inhibitors to achieve sufficient concentrations at the site of infection?

  • How can the efficiency of LspA inhibitor penetration through the Acinetobacter outer membrane be optimized?

Host-Pathogen Interactions:

  • How does the bioactive lipid secreted by A. baumannii that triggers TLR2-dependent immune signaling relate to LspA-processed lipoproteins?

  • What is the specific impact of LspA inhibition on the inflammatory response during Acinetobacter infection?

  • How might disruption of lipoprotein processing affect bacterial survival in different host environments?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.