Recombinant Acinetobacter sp. NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; ACIAD0730; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
nuoA
Target Protein Sequence
MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQFESGVVSAGGARIRLS AKFYLVAIFFVVFDLEALYLYAWATSVREVGWMGFTTMVIFVVDLLIALIYVFATGALTW SPSDRRKAAGIKPKIGSPNMNIAEITRFNSIEELVIDPTGHIPAQSSGRMKSKTSTAPSS KQE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the transmembrane orientation of nuoA in Acinetobacter species, and how does it compare to homologs in other bacteria?

NuoA is a small membrane-spanning subunit of respiratory chain NADH:quinone oxidoreductase (complex I) with no known homologues in other enzyme systems. The transmembrane orientation of NuoA cannot be unambiguously predicted due to its small size and the varying distribution of charged amino acid residues in NuoA from different organisms .

Based on studies in Escherichia coli, novel analyses of NuoA expressed as fusion proteins to cytochrome c and to alkaline phosphatase demonstrated that the C-terminal end of the polypeptide is localized in the bacterial cytoplasm . This contradicts previous reports for the homologous NQO7 subunit from Paracoccus denitrificans complex I .

For Acinetobacter species, similar fusion protein approaches can be used to determine transmembrane orientation:

Fusion PartnerDetection MethodExpected Result if C-terminus is CytoplasmicExpected Result if C-terminus is Periplasmic
Cytochrome cPeroxidase activityLow activityHigh activity
Alkaline phosphatasePhosphatase activityLow activityHigh activity
β-lactamaseAntibiotic resistanceHigh resistanceLow resistance

What experimental methods are most effective for expressing and purifying recombinant nuoA protein?

Effective expression and purification of recombinant nuoA requires addressing several challenges related to membrane protein handling:

  • Expression system selection: E. coli BL21(DE3) strains with tightly controlled inducible promoters (T7 or araBAD) are recommended for initial trials.

  • Fusion tag optimization: C-terminal His6 tags preserve native N-terminal processing while facilitating purification. For Acinetobacter nuoA specifically:

    • MBP fusion improves solubility

    • SUMO fusion enhances folding

    • TEV protease cleavage sites allow tag removal

  • Membrane extraction protocol:

    • Initial extraction with 1% DDM (n-dodecyl-β-D-maltoside)

    • Secondary extraction with 0.5% LMNG (lauryl maltose neopentyl glycol)

    • Purification via IMAC (immobilized metal affinity chromatography)

    • Final polishing via size exclusion chromatography

  • Quality control metrics:

    • SDS-PAGE: >95% purity

    • Western blot: single band at expected MW

    • Circular dichroism: predominantly α-helical spectrum

For specifically studying protein-protein interactions within complex I, consider crosslinking approaches using photoactivatable amino acid analogs incorporated during expression.

How can researchers effectively generate and characterize nuoA knockout mutants in Acinetobacter species?

  • Mutant construction approaches:

    • Homologous recombination with antibiotic resistance cassette

    • CRISPR-Cas9 editing for scarless deletions

    • Insertional inactivation with transposons

  • Phenotypic characterization panel:

    • Growth curves in standard media and under stress conditions

    • Respiratory capacity measurements (oxygen consumption, NADH oxidation)

    • Membrane potential measurements via fluorescent probes

    • Antibiotic susceptibility profiling across multiple classes

  • Molecular characterization:

    • qRT-PCR verification of knockout

    • Proteomic analysis of respiratory complex assembly

    • RNA-seq for compensatory expression changes

Based on experiences with other respiratory complex components in Acinetobacter, nuoA mutants may exhibit pleiotropic effects similar to recA mutations, potentially affecting stress responses and antibiotic susceptibility . It's crucial to verify that observed phenotypes are directly attributable to nuoA loss rather than secondary effects.

What approaches help researchers address data inconsistencies when studying nuoA function?

When encountering contradictory results in nuoA studies, researchers should implement a systematic approach to resolve discrepancies :

  • Data examination protocol:

    • Identify specific variables yielding inconsistent results

    • Verify experimental conditions are truly comparable between studies

    • Examine statistical power and outliers in datasets

    • Consider strain-specific variations in Acinetobacter species

  • Reconciliation strategies:

    • Parallel testing with standardized protocols across different laboratories

    • Sequential modification of individual variables to isolate sources of variation

    • Multi-technique validation (e.g., complementary structural approaches)

  • Decision-making framework when faced with contradictory data:

Level of ContradictionRecommended ApproachExample for nuoA Research
Minor variationsStatistical meta-analysisDifferent transmembrane topology predictions
Fundamental conflictsDesign critical experiment to distinguish modelsDirect experimental determination of C-terminus location
Irreproducible findingsSystematic evaluation of experimental variablesTest for strain-specific differences in nuoA function
  • Documentation practices:

    • Maintain detailed records of all experimental conditions

    • Report negative and contradictory results

    • Share raw data to enable independent analysis

When applying these approaches specifically to nuoA in Acinetobacter, researchers should consider that contradictions may arise from genuine biological differences between strains or experimental conditions rather than methodological errors .

What techniques can determine if nuoA contributes to antibiotic resistance in Acinetobacter species?

To investigate potential links between nuoA and antibiotic resistance in Acinetobacter, a multi-faceted approach drawing from established protocols for other respiratory components is recommended:

  • Antibiotic susceptibility testing framework:

    • Minimum inhibitory concentration (MIC) determination for wild-type vs. nuoA mutants

    • Time-kill assays to assess killing kinetics

    • Checkerboard assays for synergistic effects with other antibiotics

    • Population analysis profiling to detect heteroresistance

  • Target antibiotics for comparative testing:

Antibiotic ClassRepresentative AgentsRationale for Testing
β-lactamsImipenem, ceftazidimeMay be affected by membrane potential changes
QuinolonesCiprofloxacin, levofloxacinPotentially affected by respiratory function
PolymyxinsColistinMembrane interaction may be altered
AminoglycosidesTobramycin, amikacinUptake depends on membrane potential
TetracyclinesTigecyclineEfflux may be affected by energetics
  • Mechanistic investigations:

    • Membrane potential measurements using DiOC2(3)

    • Intracellular antibiotic accumulation assays

    • Expression analysis of efflux pumps and resistance genes

    • Complementation studies with wild-type nuoA

Based on findings from recA mutants in A. baumannii, which showed 2-4 fold higher susceptibility to β-lactams and 15-30 fold higher susceptibility to quinolones , researchers should test similar antibiotic panels when investigating nuoA's potential role in resistance mechanisms.

How can researchers effectively investigate protein-protein interactions involving nuoA within the respiratory complex?

Investigating protein-protein interactions involving nuoA requires specialized approaches for membrane proteins:

  • In vivo interaction mapping:

    • Bacterial two-hybrid systems modified for membrane proteins

    • FRET-based approaches using fluorescently tagged components

    • Split-GFP complementation assays

    • In vivo crosslinking with photoactivatable amino acid analogs

  • Biochemical approaches:

    • Co-immunoprecipitation with mild detergents

    • Blue native PAGE for complex stability analysis

    • Hydrogen-deuterium exchange mass spectrometry

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Structural biology integration:

    • Negative-stain electron microscopy of isolated complexes

    • Cryo-electron microscopy for high-resolution structure

    • Integrative modeling combining low-resolution data

  • Interaction validation strategy:

    • Site-directed mutagenesis of predicted interaction interfaces

    • Compensatory mutations to restore disrupted interactions

    • Heterologous expression systems for isolated component testing

For Acinetobacter nuoA specifically, researchers should be aware that its small size and transmembrane nature present particular challenges for interaction studies, making complementary approaches particularly valuable.

How should researchers interpret data from functional studies when nuoA mutations demonstrate pleiotropic effects?

Pleiotropic effects from nuoA mutations require careful experimental design and data interpretation:

  • Distinguishing direct vs. indirect effects:

    • Temporal analysis tracking primary vs. secondary changes

    • Dosage-dependent studies using controlled expression

    • Acute vs. chronic disruption comparisons

    • Targeted reversal experiments with complementation

  • Control selection framework:

    • Include multiple reference strains beyond wild-type

    • Use partial loss-of-function mutants

    • Include mutations in functionally related but distinct genes

    • Consider inducible expression systems for temporal control

  • Data interpretation guidelines:

    • Establish causal relationships through intervention studies

    • Use multivariate analysis to identify clusters of related phenotypes

    • Apply network analysis to position nuoA effects within cellular systems

    • Develop predictive models and test with focused experiments

What bioinformatic approaches are most valuable for analyzing nuoA sequence and structure across Acinetobacter species?

For comprehensive bioinformatic analysis of nuoA in Acinetobacter species:

  • Sequence analysis pipeline:

    • Multiple sequence alignment with MUSCLE or MAFFT

    • Phylogenetic tree construction using maximum likelihood methods

    • Conservation analysis using ConSurf or similar tools

    • Coevolution analysis to identify functionally linked residues

  • Structural prediction workflow:

    • Transmembrane topology prediction using consensus from multiple tools (TMHMM, TOPCONS)

    • Ab initio structure prediction using AlphaFold or RoseTTAFold

    • Molecular dynamics simulations to assess stability in membrane environment

    • Functional site prediction based on evolutionary conservation

  • Comparative genomics approach:

    • Pan-genome analysis across Acinetobacter species

    • Synteny analysis of nuoA genomic context

    • Selection pressure analysis (dN/dS) to identify functionally important regions

    • Horizontal gene transfer assessment

  • Integration with experimental data:

    • Structure validation with experimental constraints

    • Functional annotation based on mutagenesis results

    • Model refinement using crosslinking distance constraints

These approaches can help researchers understand nuoA variation across Acinetobacter species and predict functional consequences of natural or engineered variants.

How might nuoA be utilized in vaccine development strategies against Acinetobacter infections?

While nuoA itself has not been specifically evaluated as a vaccine candidate, insights from vaccinomics approaches for Acinetobacter can inform potential strategies:

  • Epitope prediction and validation workflow:

    • B-cell and T-cell epitope prediction using immunoinformatics tools

    • Conservation analysis across clinical isolates

    • Accessibility assessment based on membrane topology

    • Experimental validation using synthetic peptides

  • Multi-epitope vaccine design considerations:

    • Combination with established immunogenic proteins (e.g., OmpA family proteins, TonB-dependent siderophore receptors)

    • Use of appropriate linkers (GPGPG) to preserve epitope structures

    • Addition of adjuvants such as cholera toxin B subunit to enhance immunogenicity

    • Codon optimization for expression system

  • Evaluation strategy for nuoA-based vaccine components:

    • In silico validation through molecular dynamics simulation

    • Binding energy estimation with immune receptors

    • In vitro assessment of immune cell activation

    • Animal model testing for protective efficacy

Based on successful approaches with other membrane proteins, nuoA epitopes could potentially be incorporated into multi-epitope vaccines designed to target multiple components of Acinetobacter simultaneously, enhancing protective efficacy against this multidrug-resistant pathogen .

What experimental approaches might elucidate nuoA's role in Acinetobacter pathogenicity and stress responses?

To investigate nuoA's potential role in pathogenicity and stress responses:

  • Stress response characterization panel:

    • Oxidative stress (H₂O₂, menadione, sodium nitroprusside)

    • Nitrosative stress (NO donors)

    • Temperature extremes and heat shock

    • Desiccation resistance

    • pH tolerance range

  • Virulence assessment framework:

    • Macrophage infection models

    • Galleria mellonella infection model

    • Murine pneumonia model

    • Biofilm formation assays

    • Adherence to epithelial cells

  • Molecular mechanism investigations:

    • Transcriptomics under various stress conditions

    • Metabolomics to track energetic adaptations

    • Protein-protein interaction network during stress

    • Signaling pathway activation analysis

This approach builds on knowledge from other Acinetobacter components like RecA, which has shown involvement in both stress responses and virulence . Similar connections may exist for nuoA through its role in cellular energetics and membrane function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.