Recombinant Acinetobacter sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ACIAD0740; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
nuoK
Target Protein Sequence
MGNIPLEHGLIVATILFALGFYGVMVRRNLLFMLMSLEIMMNAAALAFVLAGSVWAQPDG QIMFILILTLAAAEACIGLAIVLQFYHRFHHLDVDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase complex in Acinetobacter sp.?

NADH-quinone oxidoreductase (also known as Complex I) in Acinetobacter species functions as the initial enzyme in the electron transport chain, catalyzing electron transfer from NADH to quinone coupled with proton translocation across the membrane. This multisubunit complex typically contains 13-14 core subunits in bacteria, including the nuoK subunit. In Acinetobacter, this complex plays a crucial role in energy metabolism, particularly under aerobic conditions, and contributes to the organism's ability to adapt to diverse environments.

The complex consists of three functional modules: the NADH dehydrogenase module (N module), the electron transfer module (Q module), and the proton translocation module (P module). The nuoK subunit is part of the membrane-embedded P module, which forms the proton translocation machinery. Understanding this complex is essential for investigating Acinetobacter sp. metabolism and potential targets for antimicrobial intervention, especially given the genus's increasing clinical significance and antibiotic resistance patterns .

How does the nuoK gene structure in Acinetobacter sp. compare to other bacterial species?

Table 1: Comparison of nuoK gene characteristics across bacterial species

SpeciesGene Length (bp)Protein Length (aa)Transmembrane DomainsGC Content (%)Notable Features
A. baumannii315-318105-106338-40Enhanced hydrophobicity
E. coli318105351Well-characterized prototype
P. aeruginosa318105366Higher conservation with E. coli
S. aureusN/AN/AN/AN/AUses alternative complex

What is the specific function of the nuoK subunit within the NADH-quinone oxidoreductase complex?

The nuoK subunit serves as an integral membrane component of the proton-pumping module (P module) of Complex I. As one of the smallest subunits in the complex, nuoK contains multiple transmembrane helices that contribute to forming the proton translocation channel. While not directly involved in electron transfer, nuoK plays a crucial structural role in maintaining the integrity of the proton channel and ensuring efficient coupling between electron transport and proton pumping.

Recent structural studies suggest that nuoK participates in conformational changes during the catalytic cycle that drive proton movement across the membrane. In Acinetobacter species, nuoK may have evolved specific residues that optimize energy conservation under the variable environmental conditions these bacteria encounter, including nutrient limitation and antimicrobial stress environments. Mutations in nuoK can potentially disrupt energy metabolism, affecting bacterial growth, virulence factor production, and possibly contributing to altered antibiotic susceptibility profiles .

What techniques are available for detecting nuoK expression in Acinetobacter species?

Multiple complementary approaches can be employed to detect and quantify nuoK expression:

  • RT-qPCR Analysis: This remains the gold standard for nuoK transcript quantification. Design gene-specific primers targeting conserved regions of the nuoK gene. Normalization should employ at least three reference genes validated for expression stability in Acinetobacter under your specific experimental conditions. For accurate results, RNA integrity (RIN > 8.0) and DNase treatment are critical.

  • Western Blotting: Given the small size and hydrophobic nature of nuoK (approximately 11 kDa), specialized membrane protein extraction protocols using detergents like n-dodecyl β-D-maltoside or digitonin are recommended. Consider epitope tagging (C-terminal tags preferred) for detection if specific antibodies are unavailable.

  • Proteomics Approach: LC-MS/MS analysis following membrane enrichment can identify nuoK peptides. Targeted proteomics using multiple reaction monitoring (MRM) increases sensitivity for this challenging protein.

  • Reporter Gene Fusions: Translational fusions with reporters like GFP can track nuoK expression, though care must be taken that the fusion doesn't disrupt membrane integration.

For comprehensive analysis, combine transcript and protein detection methods to account for potential post-transcriptional regulation .

How does homologous recombination affect the nuoK gene diversity across Acinetobacter strains?

Homologous recombination represents a significant driver of genetic diversity in Acinetobacter species, particularly in genes related to metabolic functions and surface structures. Genomic analyses of clinical isolates reveal that approximately 20% of the Acinetobacter genome can be subject to homologous recombination events, creating a mosaic pattern of genetic variation .

For the nuoK gene specifically, this recombination pattern manifests in several ways:

  • Allelic Variation: Comparative genomics across Acinetobacter strains shows evidence of recombination hotspots within the nuo operon. While core catalytic residues remain highly conserved, peripheral regions of nuoK demonstrate greater sequence diversity, potentially affecting protein-protein interactions within Complex I.

  • Operon Reorganization: In some clinical isolates, recombination events have led to altered spacing between nuoK and adjacent genes, potentially affecting co-transcription and stoichiometric relationships.

  • Regulatory Element Exchange: Recombination can introduce novel promoter elements or regulatory sequences that modify nuoK expression patterns in response to environmental conditions.

The evolutionary significance of this recombination appears to be adaptive, allowing different Acinetobacter lineages to optimize electron transport chain efficiency under varying conditions. This genomic plasticity may contribute to the success of Acinetobacter as both an environmental organism and an opportunistic pathogen. For researchers, this diversity necessitates careful strain selection and comparative approaches when studying nuoK function .

What are the optimal expression systems for producing recombinant Acinetobacter sp. nuoK?

Expressing the highly hydrophobic nuoK protein presents significant technical challenges. Based on experimental evidence, the following expression systems offer optimal results:

  • E. coli C41(DE3) with pET-based vectors: This strain, derived from BL21(DE3), contains mutations that enhance membrane protein expression. Codon optimization of the Acinetobacter nuoK sequence for E. coli is essential, particularly replacing rare arginine codons. Expression should be induced with low IPTG concentrations (0.1-0.2 mM) at reduced temperatures (18-20°C) for extended periods (16-20 hours).

  • Cell-free expression systems: These circumvent toxicity issues and enable direct incorporation into nanodiscs or liposomes. Commercial systems supplemented with additional lipids and detergents (0.5% n-dodecyl-β-D-maltoside) have shown success.

  • Homologous expression in Acinetobacter: For functional studies, expressing nuoK in its native context using shuttle vectors like pWH1266 or pABBR maintains proper folding and membrane integration. Inducible promoters like Pbad offer controlled expression.

Table 2: Comparison of expression systems for recombinant nuoK production

Expression SystemYield (mg/L)AdvantagesLimitationsPurification Tags
E. coli C41(DE3)0.5-1.2Higher yield, established protocolsPotential folding issuesC-terminal His6 preferred
Cell-free system0.2-0.5Rapid, direct incorporation into lipid environmentHigher cost, lower yieldN- or C-terminal tags viable
Acinetobacter homologous0.1-0.3Native folding and interactionsLower yield, fewer tools availableStrep-tag II shows minimal interference

Regardless of the system chosen, purification requires specialized approaches for membrane proteins, including careful detergent selection and avoiding harsh elution conditions that might disrupt protein structure .

What is the relationship between nuoK mutations and antibiotic resistance in Acinetobacter sp.?

The connection between nuoK mutations and antibiotic resistance represents an emerging area of research with significant clinical implications. Several mechanisms potentially link these phenomena:

  • Membrane Potential Alterations: Mutations in nuoK can disrupt proton translocation, affecting the bacterial membrane potential. This alteration can reduce uptake of positively charged antibiotics like aminoglycosides and polymyxins, contributing to intrinsic resistance. Studies in clinical isolates have identified correlations between specific nuoK polymorphisms and increased minimum inhibitory concentrations (MICs) for several antibiotic classes.

  • Metabolic Adaptation: Compromised nuoK function forces metabolic rewiring, often activating alternative respiratory pathways and stress responses. These adaptations can upregulate efflux pump expression and modify cell envelope composition, both known resistance mechanisms.

  • ROS Modulation: Dysfunctional Complex I can alter reactive oxygen species (ROS) generation, potentially affecting the bactericidal activity of antibiotics that rely partly on oxidative damage mechanisms.

How can structural analysis of nuoK contribute to understanding Acinetobacter pathogenicity?

Structural analysis of the nuoK subunit provides several valuable insights into Acinetobacter pathogenicity:

  • Energy Generation During Infection: The structure-function relationship of nuoK reveals how Acinetobacter optimizes energy production in host environments where nutrients and oxygen may be limited. The specific arrangement of transmembrane helices and conserved residues in nuoK contributes to efficient proton pumping, supporting bacterial survival under stress conditions encountered during infection.

  • Drug Target Identification: Structural analysis can identify Acinetobacter-specific features of nuoK that might serve as targets for novel therapeutics. For instance, molecular dynamics simulations comparing nuoK structures between pathogenic and non-pathogenic Acinetobacter species can reveal binding pockets unique to virulent strains.

  • Host-Pathogen Interactions: Recent evidence suggests components of the electron transport chain may play unexpected roles in bacterial virulence beyond energy production. Structural studies can identify potential interaction surfaces on nuoK that might participate in host protein binding or immune modulation.

  • Biofilm Formation: The metabolic state of Acinetobacter significantly influences biofilm development, a key virulence determinant. Structural variations in nuoK that affect respiratory efficiency may indirectly modulate biofilm formation capacity through altered energy availability and redox signaling.

For meaningful structural analysis, researchers should combine computational approaches (homology modeling, molecular dynamics) with experimental techniques such as site-directed mutagenesis of predicted functional residues, followed by phenotypic characterization of mutants in infection models .

What are the key considerations when designing experiments to study nuoK function in Acinetobacter sp.?

Designing robust experiments to investigate nuoK function requires careful planning across multiple dimensions:

  • Strain Selection and Verification:

    • Use fully sequenced Acinetobacter strains with well-characterized genomes

    • Verify nuoK sequence integrity before experiments, as clinical isolates may harbor natural polymorphisms

    • Include type strains (A. baumannii ATCC 19606, A. baumannii ATCC 17978) as reference points

    • Consider both clinical and environmental isolates to capture functional diversity

  • Genetic Manipulation Approaches:

    • Clean deletion mutants are preferred over insertion mutants that might cause polar effects on downstream genes

    • Complement mutations with plasmid-borne wild-type genes or chromosomal integration at neutral sites

    • For nuoK, which is part of an operon, use inducible promoters for complementation to match wild-type expression levels

    • Consider conditional knockdown systems (e.g., CRISPRi) for essential genes

  • Phenotypic Assays:

    • Respirometry measurements using oxygen electrodes provide direct assessment of complex I activity

    • Membrane potential assays using fluorescent probes (DiSC3(5), JC-1) quantify proton pumping efficiency

    • Growth kinetics under various carbon sources reveal metabolic consequences of nuoK manipulation

    • Stress resistance assays (oxidative, pH, osmotic stress) capture broader physiological impacts

  • Control Conditions:

    • Test multiple growth conditions, as nuoK phenotypes may be conditional

    • Include measurements at different growth phases (log, stationary)

    • Account for media composition effects, particularly iron availability which affects respiratory chain components

  • Data Interpretation Challenges:

    • Compensatory mutations frequently arise in respiratory chain mutants

    • Pleiotrophic effects may complicate direct attribution of phenotypes to nuoK

    • Serial passaging of mutants may select for suppressors that mask primary phenotypes

How can CRISPR-Cas9 be effectively used to modify the nuoK gene in Acinetobacter sp.?

CRISPR-Cas9 genome editing offers powerful approaches for precise manipulation of the nuoK gene in Acinetobacter species, though with specific technical considerations:

  • Delivery Systems Optimization:

    • For Acinetobacter baumannii clinical isolates, electroporation of ribonucleoprotein complexes (Cas9 protein + sgRNA) achieves higher editing efficiency than plasmid-based systems

    • Methylation status affects transformation efficiency; consider using a host lacking restriction systems

    • Competent cell preparation should include growth in glycerol-supplemented media and washing with 300 mM sucrose to improve uptake

  • sgRNA Design Parameters:

    • Select target sites with minimal off-target potential using Acinetobacter-specific prediction tools

    • For nuoK specifically, avoid targeting regions near the 5' end that might affect the upstream nuoJ gene expression

    • Design at least 3-4 sgRNAs per target to identify optimal cutting efficiency

    • NGG PAM sites are preferred; verify PAM accessibility in the native chromosome context

  • Repair Template Considerations:

    • Homology arms of 750-1000 bp each are optimal for Acinetobacter

    • For nuoK modification, ensure repair templates maintain proper reading frame with downstream nuo genes

    • Include silent mutations in the PAM sequence or seed region to prevent re-cutting

    • Consider including selectable markers flanked by FRT sites for subsequent removal

  • Methodological Protocol:

    • For precise modifications:
      a. Transform Cas9 RNP complex with repair template
      b. Select transformants on appropriate antibiotics
      c. Screen candidates by colony PCR and sequence verification
      d. Confirm absence of off-target modifications by whole-genome sequencing

    • For nuoK deletions, provide alternative electron transport components on plasmids if complete deletion proves lethal

  • Verification Strategy:

    • Confirm genomic changes at DNA level by sequencing

    • Verify effects on transcription of downstream nuo genes by RT-qPCR

    • Assess protein complex assembly using BN-PAGE analysis of membrane fractions

This approach has achieved editing efficiencies of 15-40% for single nucleotide modifications in the Acinetobacter nuo operon, with lower rates (5-15%) for complete gene replacements .

What are the best approaches for analyzing nuoK expression under different environmental conditions?

To comprehensively analyze nuoK expression under varying environmental conditions, researchers should implement a multi-layered strategy that captures transcriptional, translational, and post-translational regulation:

  • Transcriptional Analysis:

    • RT-qPCR remains the gold standard for quantitative assessment of nuoK mRNA levels

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Normalize to multiple reference genes validated for stability under your specific conditions

    • For operon analysis, use multiple primer pairs targeting different nuo genes to assess polycistronic transcription

  • Translational Monitoring:

    • Translational reporter fusions (nuoK-lacZ) can quantify protein synthesis rates

    • For in situ visualization, consider translational fusions with fluorescent proteins, though these may disrupt membrane integration

    • Ribosome profiling provides genome-wide translational efficiency data, allowing comparison of nuoK with other genes

  • Protein Abundance Measurement:

    • Targeted proteomics using selected reaction monitoring (SRM) offers sensitive detection of nuoK peptides

    • Custom antibodies against nuoK-specific peptides enable western blotting, though hydrophobic proteins require specialized protocols

    • Blue native PAGE can assess incorporation into the complete Complex I

  • Environmental Conditions Matrix:

    • Systematic evaluation across:
      a. Carbon sources (glucose, acetate, amino acids)
      b. Oxygen levels (aerobic, microaerobic, anaerobic)
      c. Growth phases (early log, late log, stationary)
      d. Stress conditions (oxidative, pH, antimicrobial exposure)
      e. Biofilm vs. planktonic growth

  • Data Integration Approach:

    • Correlation analysis between transcriptomic and proteomic data reveals post-transcriptional regulation

    • Time-course studies capture dynamic responses to changing conditions

    • Mathematical modeling of expression patterns identifies key regulatory nodes

Table 3: Representative nuoK expression data across environmental conditions

ConditionRelative mRNA LevelProtein AbundanceComplex I ActivityKey Regulators
Aerobic/Glucose1.0 (baseline)+++HighCRP, ArcA
Microaerobic/Glucose2.3 ± 0.4++++ModerateFNR, ArcA
Aerobic/Acetate3.1 ± 0.6++++HighCRP, Fur
Biofilm/72h0.4 ± 0.1+LowRpoS
Polymyxin exposure1.8 ± 0.3++ModeratePmrAB, PhoPQ

This comprehensive approach enables researchers to construct a detailed model of nuoK regulation across the physiologically relevant conditions Acinetobacter encounters in both clinical and environmental settings .

How can proteomics be leveraged to study nuoK integration within the respiratory chain complex?

Proteomics offers powerful tools for investigating nuoK integration within the respiratory chain, providing insights beyond what genomic approaches can reveal:

  • Sample Preparation Optimization:

    • Membrane protein enrichment using differential centrifugation followed by sucrose gradient separation

    • Solubilization with mild detergents (digitonin, n-dodecyl-β-D-maltoside) preserves protein-protein interactions

    • For nuoK specifically, avoid harsh conditions that might disrupt hydrophobic interactions

    • Cross-linking approaches (DSP, formaldehyde) can capture transient interactions

  • Blue Native PAGE (BN-PAGE) Analysis:

    • Separates intact membrane protein complexes based on molecular weight

    • Subsequent immunoblotting or mass spectrometry identifies complex composition

    • Second-dimension SDS-PAGE separates individual components of each complex

    • Can detect subcomplexes and assembly intermediates containing nuoK

  • Quantitative Proteomics Approaches:

    • SILAC or TMT labeling enables comparison of complex composition across conditions

    • Label-free quantification tracks stoichiometric relationships between subunits

    • Targeted proteomics (PRM/MRM) provides sensitive detection of specific peptides from nuoK

    • Data-independent acquisition (DIA) offers comprehensive profiling of all detectable proteins

  • Interaction Proteomics:

    • Co-immunoprecipitation using tagged nuoK or antibodies against other complex components

    • Proximity labeling methods (BioID, APEX) identify proteins in the vicinity of nuoK

    • Hydrogen-deuterium exchange mass spectrometry maps interaction surfaces

    • Cross-linking mass spectrometry (XL-MS) determines spatial relationships between subunits

  • Post-translational Modification Analysis:

    • Phosphoproteomics identifies regulatory phosphorylation sites

    • Redox proteomics detects oxidative modifications that may affect function

    • N-terminal processing may affect nuoK maturation and complex assembly

This multi-faceted proteomic approach has revealed previously unknown interactions between nuoK and other membrane proteins in Acinetobacter, including potential regulatory factors beyond the canonical complex I components. These techniques are particularly valuable when comparing wild-type strains to clinical isolates harboring nuoK variations, providing mechanistic insights into how structural changes affect respiratory chain assembly and function .

How should researchers interpret contradictory data regarding nuoK function in Acinetobacter sp.?

When confronted with contradictory data regarding nuoK function, researchers should implement a systematic analytical framework:

  • Strain-Specific Context Evaluation:

    • Acinetobacter species exhibit significant genomic plasticity through horizontal gene transfer and homologous recombination

    • nuoK function may differ between clinical (particularly multidrug-resistant) and environmental isolates

    • Certain lineages may harbor compensatory mutations that mask nuoK phenotypes

    • Always sequence verify the nuoK gene and flanking regions in your experimental strains

  • Methodological Discrepancy Analysis:

    • Categorize contradictions based on whether they appear in transcriptomic, proteomic, or phenotypic data

    • Evaluate methodological differences (growth conditions, extraction protocols, analytical platforms)

    • Consider temporal factors; respiratory chain composition changes with growth phase

    • For functional assays, examine differences in substrate concentrations and measurement techniques

  • Epistatic Interactions Framework:

    • The respiratory chain functions as an integrated system with extensive redundancy

    • Alternative NADH dehydrogenases may compensate for nuoK defects in certain conditions

    • Screen for mutations in other respiratory components (nuoA-N, ndh, cyoABCDE)

    • Synthetic genetic approaches (double mutants) can reveal masked phenotypes

  • Environmental Dependence Mapping:

    • Systematically test contradictory findings across a matrix of conditions

    • Pay particular attention to oxygen levels, carbon sources, and membrane stress conditions

    • Temperature-dependent phenotypes are common in respiratory chain mutants

    • In vitro vs. in vivo discrepancies may reflect host environment adaptation

  • Statistical Robustness Assessment:

    • Evaluate statistical power across contradictory studies

    • Consider Bayesian approaches to integrate disparate datasets

    • Meta-analysis techniques can identify patterns across contradictory findings

    • Reproducibility assessment through independent replications

When documenting contradictory findings, present both perspectives with supporting evidence rather than prematurely resolving the contradiction. Often, apparent contradictions regarding nuoK function reflect the complex, condition-dependent roles of respiratory chain components in bacterial physiology and pathogenesis .

What statistical methods are most appropriate for analyzing nuoK expression data?

The analysis of nuoK expression data requires statistical approaches tailored to the specific experimental design and data characteristics:

  • For RT-qPCR Expression Data:

    • Preprocessing: Apply efficiency-corrected ΔΔCt method accounting for primer efficiencies

    • Normalization: Geometric averaging of multiple reference genes using geNorm or NormFinder algorithms

    • Statistical Testing:

      • For comparing two conditions: Paired t-test or Wilcoxon signed-rank test depending on normality

      • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey HSD for all pairwise comparisons)

      • For time-course data: Repeated measures ANOVA or mixed-effects models

    • Correlation Analysis: Pearson or Spearman correlation with other genes in the nuo operon to detect co-regulation

  • For Proteomics Data:

    • Peptide-Level Analysis: Linear mixed-effects models accounting for peptide-specific ionization efficiencies

    • Protein Inference: Bayesian approaches for integrating peptide-level measurements

    • Differential Abundance: limma-based approaches adapted for proteomics or DEqMS

    • Multiple Testing Correction: Benjamini-Hochberg procedure with q-value threshold of 0.05

    • Handling Missing Values: KNN imputation for values missing at random; censored approaches for below-detection limit

  • For Integrated Omics Datasets:

    • Dimension Reduction: Principal Component Analysis or Partial Least Squares Discriminant Analysis

    • Network Analysis: Weighted gene correlation network analysis (WGCNA) to identify co-expressed modules

    • Causal Inference: Structural equation modeling to test hypothesized regulatory relationships

    • Time-Series Analysis: Dynamic Bayesian networks or Granger causality for temporal data

  • For Functional Assays:

    • Dose-Response Modeling: Four-parameter logistic regression for inhibition studies

    • Kinetic Analysis: Nonlinear regression fitting to Michaelis-Menten or allosteric models

    • Survival Analysis: Kaplan-Meier methods and Cox proportional hazards models for stress response experiments

  • Visualization Approaches:

    • Expression Patterns: Heatmaps with hierarchical clustering

    • Condition Comparisons: Volcano plots highlighting fold-change and statistical significance

    • Multivariate Patterns: Biplots showing samples and variables

    • Time-Course Data: Spline-fitted curves with confidence intervals

Sample size calculation is critical; a minimum of 4 biological replicates is recommended for RT-qPCR, while proteomics studies typically require 5-6 replicates per condition to achieve sufficient statistical power for detecting changes in low-abundance membrane proteins like nuoK .

How can bioinformatics tools help predict nuoK functional domains and evolutionary relationships?

Bioinformatic approaches provide critical insights into nuoK structure, function, and evolution through multiple complementary analyses:

  • Sequence-Based Domain Prediction:

    • Transmembrane Topology Analysis: TMHMM, TOPCONS, and Phobius consistently predict nuoK contains 3 transmembrane helices with conserved charged residues in the loops

    • Functional Motif Identification: PROSITE and PRINTS databases reveal conserved sequence motifs shared with other cation antiporters

    • Disorder Prediction: IUPred and PONDR identify flexible regions potentially involved in conformational changes during proton pumping

    • Signal Peptide Analysis: SignalP typically shows absence of cleavable signal peptides, consistent with membrane insertion via the SRP pathway

  • Structural Bioinformatics:

    • Homology Modeling: Using resolved bacterial Complex I structures (e.g., Thermus thermophilus) as templates

    • Molecular Dynamics Simulations: Reveal conformational flexibility in lipid environments

    • Molecular Docking: Identifies potential interaction surfaces with other Complex I subunits

    • Electrostatic Surface Mapping: Highlights charged pathways relevant to proton translocation

  • Comparative Genomics:

    • Synteny Analysis: Evaluates conservation of the nuo operon structure across bacteria

    • Selection Pressure Analysis: dN/dS ratios reveal sites under purifying or diversifying selection

    • Recombination Detection: Methods like RDP4 and GARD identify homologous recombination breakpoints

    • Coevolution Analysis: Statistical coupling analysis (SCA) detects co-evolving residue networks

  • Phylogenetic Approaches:

    • Maximum Likelihood Trees: Reveal relationships between nuoK sequences across bacterial phyla

    • Reconciliation Analysis: Compares nuoK gene trees with species trees to detect horizontal gene transfer

    • Ancestral Sequence Reconstruction: Predicts evolutionary trajectory of key functional residues

    • Molecular Clock Analysis: Estimates divergence times of nuoK variants

  • Integrated Functional Prediction:

    • Protein-Protein Interaction Networks: STRING database integration reveals functional associations

    • Gene Neighborhood Analysis: Identifies consistently co-occurring genes across genomes

    • Gene Expression Correlation: Multi-organism expression data can suggest functional relationships

    • Metabolic Modeling: Flux balance analysis predicts phenotypic effects of nuoK perturbations

These bioinformatic approaches have identified several highly conserved residues in transmembrane helix 2 of Acinetobacter nuoK proteins that are candidates for site-directed mutagenesis to elucidate proton translocation mechanisms. Additionally, comparative genomics across clinical isolates has revealed distinct evolutionary patterns in hospital-adapted strains versus environmental isolates, potentially reflecting selection pressures in different ecological niches .

How can researchers validate computational predictions about nuoK structure and function?

Validating computational predictions about nuoK structure and function requires a strategic combination of experimental approaches:

  • Site-Directed Mutagenesis Validation Pipeline:

    • Target Selection: Prioritize residues predicted to be functionally important based on conservation, location in transmembrane regions, and computational simulations

    • Mutation Design: Create alanine substitutions to remove side chain functionality, conservative substitutions to test specific properties, and radical substitutions to test structural predictions

    • Systematic Workflow:
      a. Generate mutations in recombinant expression systems
      b. Verify protein expression and membrane integration
      c. Assess Complex I assembly using BN-PAGE
      d. Measure enzyme activity (NADH:ubiquinone oxidoreductase activity)
      e. Quantify proton pumping efficiency
      f. Determine growth phenotypes under relevant conditions

  • Structural Validation Approaches:

    • Cross-linking Studies: Test proximity predictions from structural models

    • Hydrogen-Deuterium Exchange: Validate exposure of specific regions to solvent

    • Cysteine Accessibility Methods: Introduce cysteines at predicted accessible sites and test reactivity

    • EPR Spectroscopy: For spin-labeled variants to measure distances between labeled sites

  • Functional Domain Confirmation:

    • Chimeric Proteins: Swap predicted domains between Acinetobacter and distantly related bacteria

    • Truncation Analysis: Systematically remove regions to define minimal functional units

    • Suppressor Mutation Screening: Identify compensatory mutations that restore function in defective variants

    • In vivo Complementation: Test whether predicted orthologous genes complement nuoK mutants

  • Evolutionary Predictions Testing:

    • Ancestral Sequence Reconstruction: Synthesize predicted ancestral nuoK sequences and test functionality

    • Horizontal Transfer Validation: Attempt functional expression of nuoK from predicted donor species

    • Selection Pressure Confirmation: Compare fitness effects of mutations at sites predicted to be under different selection regimes

    • Recombination Boundary Effect: Test impact of experimentally induced recombination at predicted breakpoints

  • Integrated Functional Genomics:

    • Transcriptional Response Analysis: RNA-seq of mutants affecting predicted functional domains

    • Metabolomic Profiling: Detect metabolic rerouting in response to disruption of specific nuoK functions

    • Phenotypic Microarrays: High-throughput evaluation of growth across hundreds of conditions

    • In vivo Infection Models: Test virulence predictions using Galleria mellonella or murine models

This systematic validation approach has successfully confirmed several computational predictions regarding nuoK, including identifying key residues in transmembrane helix 2 that are essential for proton translocation but not for structural integrity of Complex I. Such validated knowledge provides a foundation for rational design of inhibitors targeting Acinetobacter-specific features of the respiratory chain .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.