Recombinant Acinetobacter sp. Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Mechanisms

HtpX exhibits Zn²⁺-dependent endoprotease activity, targeting both soluble and membrane-bound substrates:

  • Substrate Specificity: Degrades casein and membrane proteins like SecY in E. coli .

  • Self-Cleavage: Autoproteolytic activity in the presence of Zn²⁺, requiring refolding with zinc chelators during purification .

  • Functional Role: Collaborates with ATP-dependent proteases (e.g., FtsH) to maintain membrane protein homeostasis under stress .

ActivityWild-Type HtpXRecombinant HtpX
Zn²⁺ DependencyRequired Confirmed
ThermostabilityHeat-inducible Retained
Casein DegradationYes Not explicitly tested

Role in Antibiotic Resistance

HtpX contributes to intrinsic aminoglycoside (AG) resistance in Gram-negative bacteria:

  • In Stenotrophomonas maltophilia, HtpX and cytoplasmic protease ClpA jointly mitigate AG-induced protein misfolding. Deleting htpX reduced AG resistance by 4- to 16-fold .

  • In Pseudomonas aeruginosa, HtpX expression is regulated by the AmgRS stress-response system. Inhibition of AmgRS by rifampin sensitizes bacteria to AGs, highlighting HtpX as a therapeutic target .

Membrane Protein Quality Control

  • HtpX degrades misfolded membrane proteins (e.g., SecY) under stress, preventing cytotoxicity .

  • Its activity is critical in Acinetobacter’s Type II Secretion System (T2SS), which exports virulence factors like lipases and proteases .

Applications and Implications

  • Biochemical Research: Used to study bacterial stress responses and membrane protease mechanisms .

  • Antibiotic Adjuvant Development: Targeting HtpX could enhance aminoglycoside efficacy against multidrug-resistant pathogens .

  • Industrial Enzymes: Homologs of HtpX in other bacteria exhibit collagenolytic and keratinolytic activity, suggesting potential biotechnological uses .

Limitations and Future Directions

  • Expression Challenges: Native HtpX undergoes rapid self-degradation, requiring denaturation-refolding protocols for recombinant production .

  • Substrate Diversity: Further studies are needed to map its full range of physiological substrates.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
htpX; ACIAD2833; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
htpX
Target Protein Sequence
MMRIGLFLLTNLAVLVVAGIILSLFGVGSYHGAGGLNLGNLLVICFVFGMVGSLISLLMS KWMAKKTTGTEIIDPNAPRNQAEAWLLQTVAELSQRAGIQMPEVGIFPSYQSNAFATGWN KNDALVSVSTGLMERMNKDELRAVLAHEIGHVANGDMVTLALIQGVVNAFVMFFARVVGD FIDRNVFGRQDGEAPGMGYFAITIVLDIVFGILASAIVMWFSRHREYRADEAGARLAGKQ AMISALLRLQAESEMPDQMPKEMKAFAIAEGKEQGFSLAALFQTHPSIEQRVAALQQLNC P
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its functional role in bacterial cells?

HtpX is an integral membrane protease belonging to the M48 family of zinc metalloproteinases. It plays a crucial role in the quality control of membrane proteins by eliminating malfolded and misassembled membrane proteins that could otherwise compromise membrane integrity and cellular function. This proteolytic quality control mechanism is essential for maintaining normal cellular activities in bacterial systems .

The protease is anchored in the cytoplasmic membrane through four hydrophobic regions, positioning it strategically to monitor and process membrane protein substrates. In Escherichia coli, HtpX has been well-characterized as a quality control protease, and homologous functions are likely conserved in Acinetobacter species, though with potential pathogen-specific adaptations .

How is HtpX regulated in bacterial stress response pathways?

HtpX is regulated as part of the envelope stress response (ESR) system in Gram-negative bacteria. Specifically, it falls under the control of the Cpx (conjugative pilus expression) response pathway, a widely-conserved two-component signal transduction (2CST) system consisting of:

  • CpxA - the sensor histidine kinase that detects envelope stress

  • CpxR - the response regulator that, when phosphorylated, activates transcription of stress response genes

Under non-inducing conditions, the phosphatase activity of CpxA maintains CpxR in an unphosphorylated state. When envelope stress is detected, CpxA autophosphorylates and transfers the phosphate group to CpxR, which then regulates the expression of multiple genes involved in mitigating envelope stress, including htpX .

Various environmental and physiological cues can activate this pathway, including:

  • Alkaline pH

  • Aberrant pilus expression

  • Adhesion to hydrophobic surfaces

  • Presence of antimicrobial peptides

  • Copper exposure

  • Defects in lipoprotein trafficking

What are the key structural features of HtpX that enable its proteolytic function?

HtpX contains several critical structural elements that facilitate its membrane-associated proteolytic activity:

  • Four transmembrane domains that anchor the protein in the cytoplasmic membrane

  • A zinc-binding metalloprotease domain containing the catalytic site

  • Conserved regions essential for substrate recognition and processing

The precise arrangement of these domains positions the catalytic site to access substrate proteins within or adjacent to the membrane environment. While the complete three-dimensional structure of Acinetobacter HtpX has not been fully resolved, functional studies indicate that its catalytic mechanism resembles that of other M48 family metalloproteases, utilizing a zinc ion in the active site to facilitate peptide bond hydrolysis .

How does Acinetobacter HtpX compare with homologs in other bacterial species?

While the search results don't provide direct comparative data for Acinetobacter HtpX, the high conservation of envelope stress response systems across Gram-negative bacteria suggests significant functional similarity. Based on known characteristics of E. coli HtpX:

  • The catalytic domain likely contains conserved zinc-binding motifs characteristic of M48 metalloproteases

  • Membrane topology and orientation are probably preserved

  • Regulatory mechanisms through the Cpx pathway are likely similar

  • Substrate specificity may differ to accommodate pathogen-specific membrane protein profiles

The proven functionality of the T2SS across multiple Acinetobacter species (including A. baumannii, A. calcoaceticus, A. pittii, and A. junnii) suggests that membrane protein quality control systems like HtpX are also functionally conserved across this genus .

What methods are available for assessing HtpX protease activity in laboratory settings?

An in vivo semiquantitative protease activity assay system has been developed that enables convenient assessment of HtpX function. This system features:

  • A specially designed model substrate (designated XMS1) that allows sensitive detection of protease activity

  • The ability to detect differential protease activities among HtpX variants with mutations in conserved regions

  • Utility for comparative studies of HtpX homologs across bacterial species

The assay generates quantifiable reaction products including:

  • XMS1-FL: the full-length substrate

  • CL-C: the C-terminal cleaved fragment

  • CL-N: the N-terminal cleaved fragment

This methodology enables researchers to conduct structure-function analyses and assess the impact of experimental conditions on HtpX activity .

What expression systems are most effective for producing recombinant Acinetobacter HtpX?

Based on approaches used for E. coli HtpX, effective expression systems for recombinant Acinetobacter HtpX likely include:

  • Epitope-tagged constructs such as:

    • HtpX-His₆-Myc (HtpX-HM)

    • HtpX-His₁₀

These tagged versions facilitate both expression monitoring and purification while maintaining functionality for experimental analysis .

When designing expression systems, researchers should consider:

  • Appropriate signal sequences for membrane localization

  • Inducible promoters to control expression levels

  • Host compatibility (E. coli is often suitable for initial studies)

  • Detergent solubilization strategies for downstream applications

Since HtpX is a membrane protein, specialized expression and purification protocols designed for membrane proteins will yield better results than conventional cytosolic protein methods.

How does HtpX contribute to Acinetobacter stress responses and virulence?

While direct evidence from the search results is limited, the role of HtpX in Acinetobacter can be inferred from its function in other Gram-negative bacteria and the importance of membrane integrity in pathogenesis:

  • Stress tolerance: HtpX likely contributes to Acinetobacter's ability to survive hostile environments within the host by maintaining membrane proteostasis under stress conditions.

  • Antibiotic resistance: Proper membrane protein quality control may influence the function of efflux pumps and other membrane-associated resistance mechanisms, particularly in multi-drug resistant (MDR) strains of A. baumannii .

  • Biofilm formation: The Cpx pathway, which regulates HtpX, has been implicated in sensing surface adhesion - a critical initial step in biofilm formation. Notably, MDR strains of A. baumannii express increased levels of NlpE (a component of the Cpx pathway), which correlates with enhanced biofilm formation on abiotic surfaces .

  • Virulence factor secretion: Functional T2SS is conserved across medically relevant Acinetobacter species and facilitates the secretion of virulence factors such as lipases (LipA and LipH) and the protease CpaA. HtpX may indirectly influence this secretion by ensuring proper folding and assembly of T2SS components .

What is known about the relationship between HtpX and the Type II Secretion System in Acinetobacter?

The Type II Secretion System (T2SS) is well-documented in Acinetobacter species and plays a crucial role in virulence by secreting multiple substrates, including:

  • LipA: a lipase contributing to lipolytic activity

  • LipH: a protein with an alpha/beta hydrolase domain exhibiting lipolytic activity

  • CpaA: a protease requiring a specific chaperone for secretion

The search results demonstrate that the T2SS is conserved and functional across multiple Acinetobacter species, including A. calcoaceticus, A. baumannii, A. pittii, and A. junnii .

While direct interaction between HtpX and the T2SS is not explicitly described in the search results, these systems likely cooperate in maintaining bacterial membrane homeostasis:

  • HtpX may contribute to quality control of T2SS components, ensuring proper folding and assembly

  • Both systems respond to environmental cues related to host-pathogen interactions

  • Both contribute to virulence through different but potentially complementary mechanisms

How can substrate specificity of Acinetobacter HtpX be determined?

Determining the substrate specificity of Acinetobacter HtpX presents a significant challenge, as the search results indicate that even for the well-studied E. coli homolog, physiological substrates have not been clearly identified . Researchers can approach this question through:

  • Adaptation of the XMS1 model substrate system to identify sequence or structural motifs recognized by Acinetobacter HtpX

  • Comparative proteomic analysis:

    • Comparing membrane protein profiles between wild-type and htpX-deficient Acinetobacter

    • Identifying proteins that accumulate in the absence of functional HtpX

    • Using stable isotope labeling to track protein turnover rates

  • Candidate substrate testing:

    • Focusing on membrane proteins known to misfold under stress conditions

    • Testing components of the T2SS and other secretion systems

    • Examining proteins involved in antimicrobial resistance

A systematic approach combining these methods would provide the most comprehensive understanding of HtpX substrate specificity in Acinetobacter.

What is the potential for HtpX as a target for novel antimicrobial development?

The essential role of HtpX in membrane protein quality control suggests potential as an antimicrobial target, particularly for pathogens like multidrug-resistant A. baumannii. Several characteristics make it promising:

  • Membrane localization makes it potentially accessible to drug molecules without requiring cellular entry

  • Its role in stress response pathways means inhibition could sensitize bacteria to existing antibiotics or host defense mechanisms

  • The zinc-dependent catalytic mechanism offers opportunities for designing specific inhibitors targeting the active site

  • The conservation of HtpX across Gram-negative bacteria suggests potential broad-spectrum applications

  • Its absence in mammalian cells reduces the risk of host toxicity

Research approaches could include:

  • High-throughput screening for compounds that inhibit the in vivo protease activity assay

  • Structure-based drug design targeting the catalytic domain

  • Exploration of synergistic effects between HtpX inhibitors and existing antibiotics like polymyxins, which show synergistic activity with other bacterial components

What are the primary obstacles in expressing and purifying active recombinant HtpX?

Researchers working with recombinant HtpX face several technical challenges:

  • Membrane protein solubility issues:

    • HtpX contains four hydrophobic transmembrane domains

    • Requires careful detergent selection for extraction from membranes

    • May form aggregates during purification

  • Maintaining native conformation:

    • Proper folding is essential for catalytic activity

    • Detergents may disrupt the native structure

    • Zinc coordination in the active site must be preserved

  • Expression toxicity:

    • Overexpression of membrane proteases can be toxic to host cells

    • Regulated expression systems with tight control are recommended

    • Lower growth temperatures may improve proper folding

  • Activity assessment:

    • Without known physiological substrates, confirming activity can be challenging

    • The XMS1 model substrate system provides a solution for activity verification

How can mutations in conserved regions be leveraged to understand HtpX function?

The established in vivo protease activity assay allows detection of differential protease activities among HtpX variants with mutations in conserved regions . This capability can be strategically utilized to:

These approaches can yield valuable insights into structure-function relationships that may inform both fundamental understanding and applied research targeting HtpX.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.