Recombinant Acinetobacter sp. UPF0060 membrane protein ACIAD1364 (ACIAD1364)

What is UPF0060 membrane protein ACIAD1364 and what organism does it originate from?

UPF0060 membrane protein ACIAD1364 is a membrane protein from Acinetobacter baylyi, with a UniProt ID of Q6FCI0. It belongs to the UPF0060 protein family, a group whose specific functions are not yet fully characterized. The full-length protein consists of 101 amino acids with the sequence: MTALAEILGCYFPYLILKEGKTHWLWLPAIISLAVFVWLLTLHPAASGRIYAAYGGIYIFTALMWLRFIDQVTLTRWDIWGGTVVLLGAALIILQPQGLLK . As a membrane protein, it is integrated into the bacterial membrane, likely playing a role in membrane integrity, transport, or signaling processes.

What is the difference between native and recombinant ACIAD1364 protein?

Native ACIAD1364 protein is expressed naturally within Acinetobacter baylyi cells, containing potential post-translational modifications specific to this organism and existing in its natural membrane environment. In contrast, recombinant ACIAD1364 protein is produced in expression systems (typically E. coli) using genetic engineering techniques. The recombinant version often includes modifications such as His-tags for purification purposes and may lack some post-translational modifications present in the native form . While the recombinant form provides advantages for research including higher yield and easier purification, researchers should be aware that these modifications could potentially affect protein structure and function compared to the native protein.

How should recombinant ACIAD1364 protein be stored and handled for optimal stability?

For optimal stability, recombinant ACIAD1364 protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles. The lyophilized powder is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For working aliquots, storage at 4°C for up to one week is acceptable. When reconstituting the protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (with 50% being the default concentration) is recommended for long-term storage. Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom . Improper storage or handling can lead to protein degradation, aggregation, or loss of functional activity.

What structural and functional characteristics define the UPF0060 membrane protein family?

The UPF0060 membrane protein family, to which ACIAD1364 belongs, is characterized by several transmembrane domains and a conserved amino acid sequence pattern. Structural analysis suggests these proteins likely form alpha-helical transmembrane segments that anchor them within the bacterial membrane . The amino acid sequence of ACIAD1364 (MTALAEILGCYFPYLILKEGKTHWLWLPAIISLAVFVWLLTLHPAASGRIYAAYGGIYIFTALMWLRFIDQVTLTRWDIWGGTVVLLGAALIILQPQGLLK) indicates hydrophobic regions consistent with membrane integration, particularly in segments containing leucine-rich regions .

While the precise function remains under investigation, comparative genomics and structural analysis suggest potential roles in membrane integrity, small molecule transport, or signaling processes. Some members of this family in other bacterial species have been implicated in stress responses or antimicrobial resistance, though specific function verification for ACIAD1364 requires targeted experimental approaches including gene knockout studies, protein-protein interaction analyses, and functional assays in relevant physiological contexts.

How do expression conditions affect the yield and proper folding of recombinant ACIAD1364?

Expression conditions critically impact both yield and proper folding of recombinant ACIAD1364. As a membrane protein, ACIAD1364 presents particular challenges for recombinant expression. Key factors affecting expression include:

• Expression host selection: While E. coli is commonly used , alternative hosts like C41(DE3) or C43(DE3) strains may provide superior results for membrane proteins.

• Induction parameters: Lower induction temperatures (16-25°C) often favor proper folding over high yield, while IPTG concentration typically requires optimization between 0.1-1.0 mM.

• Media composition: Addition of glycerol (0.5-2%) and specific metal ions may enhance membrane protein expression.

• Expression duration: Extended expression periods (24-48 hours) at lower temperatures may improve proper folding.

• Membrane-mimetic additives: Including mild detergents in growth media can sometimes assist proper membrane protein folding.

A methodical approach using factorial design to test variations of these parameters is recommended to determine optimal conditions. Monitoring expression should employ both quantitative (Western blot) and qualitative (activity assays) assessments to ensure both yield and functionality are optimized.

What are the challenges in distinguishing properly folded ACIAD1364 from misfolded protein during purification?

Distinguishing properly folded ACIAD1364 from misfolded forms presents significant challenges due to the protein's membrane-associated nature. Several methodological approaches can address this issue:

• Detergent screening: A systematic evaluation of different detergents (ionic, non-ionic, and zwitterionic) is crucial, as improper detergent selection can cause protein aggregation or denaturation.

• Size exclusion chromatography (SEC): Properly folded membrane proteins typically elute at volumes corresponding to their molecular weight plus associated detergent micelles, while aggregated forms elute in the void volume.

• Circular dichroism (CD) spectroscopy: This technique can verify secondary structure content expected for alpha-helical membrane proteins like ACIAD1364.

• Thermal stability assays: Fluorescence-based thermal shift assays using dyes like SYPRO Orange can differentiate between stable, folded proteins and unstable, misfolded variants.

• Activity assays: Though challenging without known function, binding assays with predicted ligands or interaction partners can confirm functional conformation.

A combination of these approaches provides higher confidence in protein quality than any single method alone. Researchers should establish quality control benchmarks during initial purification optimization to ensure consistency across preparations .

What is the optimal protocol for extracting and purifying recombinant ACIAD1364 from E. coli?

The optimal protocol for extracting and purifying recombinant ACIAD1364 from E. coli involves several critical steps:

Extraction Steps:

• Harvest cells by centrifugation (6,000 × g for 15 minutes at 4°C)

• Resuspend cell pellet in lysis buffer (typically PBS with 1% detergent, protease inhibitors)

• Disrupt cells using sonication or high-pressure homogenization

• Centrifuge at low speed (10,000 × g for 20 minutes) to remove cell debris

• Ultracentrifuge supernatant (100,000 × g for 1 hour) to isolate membrane fraction

• Solubilize membrane pellet in extraction buffer containing appropriate detergent

Purification Steps:

• Load solubilized protein onto Ni-NTA column pre-equilibrated with binding buffer

• Wash column with increasing imidazole concentrations to remove non-specific binding

• Elute His-tagged ACIAD1364 with elution buffer containing 250-500 mM imidazole

• Perform size exclusion chromatography to separate monomeric protein from aggregates

• Concentrate purified protein using centrifugal concentrators with appropriate MWCO

Throughout the process, maintain samples at 4°C and include protease inhibitors to prevent degradation. Protein purity should be assessed by SDS-PAGE, with expected purity greater than 90% . Western blotting using anti-His antibodies can confirm identity and integrity of the full-length protein.

How can researchers effectively reconstitute ACIAD1364 into liposomes or nanodiscs for functional studies?

Effectively reconstituting ACIAD1364 into liposomes or nanodiscs requires careful consideration of lipid composition and reconstitution conditions:

Liposome Reconstitution Protocol:

• Prepare lipid mixture (typically E. coli polar lipids or synthetic mixtures like POPC/POPE/POPG)

• Dissolve lipids in chloroform, dry under nitrogen, and remove residual solvent under vacuum

• Hydrate lipid film with buffer to form multilamellar vesicles

• Subject to freeze-thaw cycles (5-10 cycles) followed by extrusion through polycarbonate filters

• Mix purified ACIAD1364 with preformed liposomes at protein:lipid ratios of 1:50 to 1:200

• Remove detergent by dialysis or using Bio-Beads SM-2

Nanodisc Reconstitution Protocol:

• Prepare mixture of purified ACIAD1364, appropriate lipids, and membrane scaffold protein (MSP)

• Optimize protein:MSP:lipid ratios (typically starting with 1:3:60)

• Add detergent (usually sodium cholate) to maintain solubility

• Initiate self-assembly by detergent removal using Bio-Beads or dialysis

• Purify resulting nanodiscs by size exclusion chromatography

Success of reconstitution should be verified using dynamic light scattering to assess size distribution, negative-stain electron microscopy to confirm morphology, and functional assays to validate activity. This approach allows for controlled study of ACIAD1364 in a membrane-like environment that more closely mimics its native context.

What analytical techniques are most effective for studying the structure-function relationship of ACIAD1364?

Multiple complementary analytical techniques are necessary for comprehensive structure-function analysis of ACIAD1364:

Structural Analysis Techniques:

• X-ray Crystallography: Requires protein crystallization, challenging for membrane proteins but provides high-resolution structures when successful

• Cryo-Electron Microscopy: Increasingly powerful for membrane proteins, avoiding crystallization requirements

• NMR Spectroscopy: Useful for dynamic studies and ligand-binding analysis

• Circular Dichroism (CD): Provides secondary structure information and thermal stability data

• FTIR Spectroscopy: Complementary to CD for secondary structure analysis in membrane environments

Functional Analysis Techniques:

• Electrophysiology: If ACIAD1364 functions as a channel or transporter

• Isothermal Titration Calorimetry (ITC): For quantitative binding studies

• Microscale Thermophoresis (MST): Detecting interactions with potential binding partners

• Surface Plasmon Resonance (SPR): Real-time binding kinetics analysis

• Fluorescence-based Assays: For monitoring conformational changes or transport activities

Computational Approaches:

• Molecular Dynamics Simulations: To study protein behavior in membrane environments

• Homology Modeling: When high-resolution experimental structures are unavailable

• Bioinformatic Analysis: For identifying conserved domains and potential functional sites

Integration of data from multiple techniques provides the most comprehensive understanding of structure-function relationships. For membrane proteins like ACIAD1364, maintaining the protein in appropriate membrane-mimetic environments throughout analysis is critical for obtaining physiologically relevant results.

How can ACIAD1364 be utilized in developing experimental vaccines against Acinetobacter species?

ACIAD1364, as an outer membrane protein, presents potential as a vaccine candidate against Acinetobacter species. The development approach typically involves:

• Antigen Preparation: Purified recombinant ACIAD1364 can be used directly or conjugated to appropriate carriers like chitosan nanoparticles, which have shown efficacy as adjuvants for outer membrane proteins .

• Adjuvant Selection: Chitosan nanoparticles have demonstrated effectiveness as both delivery systems and adjuvants for membrane proteins, enhancing immune responses in experimental models . A typical preparation involves:

  Component	Optimized Concentration
  Chitosan	2-5 mg/mL
  ACIAD1364	0.5-1 mg/mL
  Crosslinking agent	Variable based on formulation
  pH	5.5-6.5

• Immunization Protocol: Based on similar studies with Acinetobacter membrane proteins, a typical immunization schedule involves:

  Immunization	Timing	Dose
  Prime	Day 0	50-100 μg protein
  Boost 1	Day 14	50-100 μg protein
  Boost 2	Day 28	50-100 μg protein
  Challenge/Analysis	Day 42-56	-

• Immune Response Assessment: Comprehensive evaluation includes measuring:

  • Antibody titers (IgG, IgM)

  • Cytokine profiles (IL-2, IL-6, IFN-γ)

  • Leukocyte counts and differential analysis

  • Bacterial challenge studies to assess protection

Studies with similar Acinetobacter membrane proteins have shown that chitosan-loaded formulations significantly increase cytokine production and antibody titers compared to protein alone . This approach leverages both humoral and cellular immune responses, critical for protection against bacterial pathogens.

What immune responses are typically elicited by outer membrane proteins like ACIAD1364?

Outer membrane proteins like ACIAD1364 typically elicit complex immune responses involving both innate and adaptive immunity:

Innate Immune Responses:

• Pattern Recognition Receptor (PRR) Activation: Membrane proteins are recognized by Toll-like receptors (particularly TLR2 and TLR4), triggering initial inflammatory responses

• Neutrophil and Macrophage Recruitment: Leading to phagocytosis and inflammatory cytokine production

• Complement Activation: Potentially through both classical and alternative pathways

Adaptive Immune Responses:

• Humoral Immunity: Production of specific antibodies, predominantly IgG isotypes

• Cellular Immunity: Activation of CD4+ T-helper cells (primarily Th1 and Th17 responses)

• Memory Formation: Development of immunological memory for rapid response upon re-exposure

Experimental data with comparable Acinetobacter membrane proteins has shown significant increases in specific immune parameters when delivered with appropriate adjuvants like chitosan nanoparticles:

These responses suggest outer membrane proteins like ACIAD1364 can effectively stimulate both arms of the adaptive immune system when properly formulated, making them valuable potential vaccine components against Acinetobacter infections .

What are common pitfalls in expressing and purifying full-length membrane proteins like ACIAD1364?

Researchers frequently encounter several challenges when working with membrane proteins like ACIAD1364:

• Low Expression Yields: Membrane proteins often express poorly in heterologous systems due to:

  • Toxicity to host cells

  • Inefficient membrane insertion

  • Protein aggregation and inclusion body formation

  Solution: Optimize by using specialized expression strains (C41/C43), lower induction temperatures (16-20°C), and reduced inducer concentrations. Consider membrane-targeted expression systems or cell-free expression alternatives .

• Protein Misfolding: Improper folding is common when membrane proteins are overexpressed:

  Solution: Include folding modulators (chemical chaperones like glycerol or trimethylamine N-oxide) in growth media and consider fusion partners that enhance folding efficiency.

• Detergent Selection Challenges: Inappropriate detergents can cause:

  • Protein denaturation

  • Aggregation

  • Loss of function

  Solution: Systematically screen multiple detergent classes (typically 8-12 different detergents) using stability and monodispersity as quality metrics.

• Truncation Products: Full-length proteins may be difficult to obtain due to:

  • Premature translation termination

  • Proteolytic degradation during purification

  Solution: Use protease inhibitors throughout purification, optimize codons for expression host, and consider dual affinity tags (N- and C-terminal) to select for full-length protein only .

• Inconsistent Batch Quality: Membrane protein preparations often vary between batches:

  Solution: Establish rigid quality control metrics using size exclusion chromatography profiles, thermal stability assays, and functional verification to ensure consistent protein quality.

Maintaining protein stability throughout purification is critical; researchers should minimize exposure to air/foam, maintain consistent cold temperature, and verify protein integrity at each purification step.

How can researchers troubleshoot issues with protein stability and aggregation?

When facing stability and aggregation issues with ACIAD1364 or similar membrane proteins, a systematic troubleshooting approach is essential:

Diagnostic Steps:

• Characterize the Aggregation:

  • Dynamic Light Scattering (DLS) to determine particle size distribution

  • Size Exclusion Chromatography to quantify monomeric vs. aggregated fractions

  • Negative-stain Electron Microscopy to visualize aggregates

• Stability Assessment:

  • Thermal shift assays to determine melting temperature in different conditions

  • Time-course studies monitoring protein degradation by SDS-PAGE

  • Activity assays (if available) to correlate structural integrity with function

Intervention Strategies:

Stabilizing Additives to Test:

• Glycerol (10-20%)

• Specific lipids (0.1-1 mg/mL)

• Cholesterol hemisuccinate (0.01-0.1%)

• Sucrose (5-10%)

• Specific binding partners or ligands

Each protein may have unique stability requirements, so a matrix-based screening approach testing multiple conditions simultaneously is often most efficient for identifying optimal stabilization conditions .

What emerging technologies could advance structural and functional studies of ACIAD1364?

Several cutting-edge technologies show promise for advancing our understanding of membrane proteins like ACIAD1364:

• Cryo-EM Advances:

  • New direct electron detectors with improved resolution

  • AI-assisted particle picking and classification

  • Microcrystal electron diffraction (MicroED) for small crystals

  These approaches can potentially resolve structures without the need for large well-ordered crystals, a traditional bottleneck for membrane protein structural biology.

• Integrative Structural Biology:

  • Combining lower-resolution techniques (SAXS, SANS) with computational modeling

  • Cross-linking mass spectrometry (XL-MS) to map protein topology

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamics studies

• Advanced Membrane Mimetics:

  • Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Native nanodiscs preserving native lipid environments

  • Cell-derived membrane vesicles maintaining physiological context

• Single-Molecule Techniques:

  • FRET-based conformational change detection

  • Single-molecule force spectroscopy for mechanical properties

  • Correlative light and electron microscopy for in situ localization

• Functional Characterization:

  • High-throughput screening platforms for identifying interacting partners

  • Microfluidic systems for transport function assessment

  • Label-free binding detection systems with improved sensitivity

These technologies collectively address the critical challenges in membrane protein research: maintaining native-like environments, capturing dynamic behaviors, and connecting structural features to function. As they mature, they offer promising avenues to fully characterize ACIAD1364 and related membrane proteins .

How might comparative genomics and systems biology approaches enhance our understanding of ACIAD1364 function?

Integrative approaches combining comparative genomics and systems biology offer powerful strategies to decipher ACIAD1364 function:

Comparative Genomics Approaches:

• Phylogenetic Profiling: Analyzing co-occurrence patterns of ACIAD1364 across bacterial species can reveal functional relationships by identifying genes with similar evolutionary histories

• Synteny Analysis: Examining the genomic context of ACIAD1364 across species may identify consistently co-localized genes that participate in shared pathways

• Evolutionary Rate Analysis: Comparing sequence conservation patterns to identify functionally critical regions:

  Protein Region	Conservation Level	Functional Implication
  Transmembrane domains	Typically highly conserved	Core structural/functional importance
  Loop regions	Often variable	Potential species-specific adaptations
  C-terminal domain	Moderate conservation	Possible regulatory functions

Systems Biology Approaches:

• Interactome Mapping: Techniques such as bacterial two-hybrid, affinity purification-mass spectrometry, or proximity labeling to identify protein interaction partners

• Transcriptomic Analysis: RNA-seq under various conditions to identify co-regulated genes and potential regulatory networks

• Metabolomic Profiling: Comparing metabolic changes in wild-type versus gene knockout strains to identify affected pathways

• Phenotypic Screening: High-throughput phenotypic analysis of gene knockout or overexpression strains across diverse growth conditions

• Network Analysis: Integration of multiple data types (genomic, transcriptomic, proteomic) to position ACIAD1364 within cellular functional networks

By combining these approaches, researchers can generate testable hypotheses about ACIAD1364 function even in the absence of direct functional data, guiding targeted experimental validation. This integrated strategy is particularly valuable for membrane proteins like ACIAD1364 where traditional functional characterization may be challenging .