Recombinant Acinetobacter sp. UPF0761 membrane protein ACIAD3168 (ACIAD3168)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of ACIAD3168

ACIAD3168 represents a significant membrane protein within the Acinetobacter genus, specifically identified in Acinetobacter baylyi. The designation UPF0761 indicates it belongs to a family of uncharacterized protein families, suggesting that while its sequence has been determined, its precise biological function remains to be fully elucidated. Membrane proteins like ACIAD3168 are critical components of bacterial cellular architecture, serving as mediators between the intracellular and extracellular environments. These proteins typically perform essential functions including signal transduction, selective transport of molecules, and maintenance of cellular integrity in bacterial systems. The recombinant version of ACIAD3168 is produced through expression in E. coli systems, allowing for controlled production and purification for research purposes while maintaining the structural and functional properties of the native protein .

Protein Classification and Origin

ACIAD3168 is specifically classified within the UPF0761 family of membrane proteins, a grouping that indicates proteins with similar sequences but incompletely characterized functions. The protein originates from Acinetobacter baylyi, a non-pathogenic soil bacterium that shares significant genomic similarity with the clinically relevant pathogen Acinetobacter baumannii. A. baylyi has gained scientific interest due to its natural competence for genetic transformation and its environmental adaptability, making it an important model organism for studying bacterial genetics and metabolism. While A. baylyi is generally considered non-pathogenic, its relative A. baumannii has emerged as a significant nosocomial pathogen, known for its virulence in severely ill patients and multidrug resistance capabilities . Understanding membrane proteins like ACIAD3168 in the context of Acinetobacter species may provide valuable insights into bacterial adaptation, virulence mechanisms, and potential therapeutic targets.

Reconstitution Protocol and Buffer Composition

The reconstitution of lyophilized ACIAD3168 requires careful attention to buffer composition and handling procedures to ensure optimal protein stability. The recommended reconstitution buffer consists of a Tris/PBS-based solution containing 6% trehalose at pH 8.0, which provides a physiologically relevant environment that supports proper protein folding and stability. Before opening the vial containing lyophilized protein, a brief centrifugation is recommended to bring the contents to the bottom of the container, minimizing product loss. Following reconstitution, the addition of glycerol serves as a cryoprotectant to prevent damage from ice crystal formation during freezing. The careful aliquoting of the reconstituted protein is essential to avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity . These detailed reconstitution protocols reflect the sensitivity of membrane proteins to environmental conditions and the importance of proper handling for maintaining their structural and functional integrity.

Membrane Proteins in Acinetobacter Species

Membrane proteins play crucial roles in the biology of Acinetobacter species, contributing to their environmental adaptability and pathogenic potential. One well-studied example is the outer membrane protein A (OmpA) in Acinetobacter baumannii, which has been identified as a significant virulence factor involved in host-pathogen interactions. Research has shown that OmpA is subject to complex regulatory mechanisms at both transcriptional and post-transcriptional levels, highlighting the sophisticated control of membrane protein expression in these bacteria . While specific functional studies on ACIAD3168 are not detailed in the available literature, its classification as a membrane protein suggests it may participate in similar fundamental processes. Understanding the structure, function, and regulation of membrane proteins in Acinetobacter species provides important insights into bacterial adaptation, pathogenesis mechanisms, and potential targets for therapeutic intervention in infections caused by these increasingly problematic pathogens.

Research Applications and Future Directions

The availability of recombinant ACIAD3168 as a purified protein opens numerous possibilities for detailed functional and structural studies. Potential research applications include crystallography or cryo-electron microscopy for structural determination, interaction studies with potential binding partners or substrates, and functional assays to elucidate its biological role. The protein's His-tag facilitates not only purification but also detection in experimental settings using anti-His antibodies or other affinity-based methods. Future research directions might explore ACIAD3168's potential role in membrane dynamics, cellular processes specific to Acinetobacter species, or comparative studies with homologous proteins in related bacteria . Additionally, understanding the function of UPF0761 family proteins more broadly could provide valuable insights into bacterial physiology and potentially reveal new targets for antimicrobial development in an era of increasing antibiotic resistance, particularly in the clinically relevant Acinetobacter genus.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACIAD3168; UPF0761 membrane protein ACIAD3168
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-419
Protein Length
full length protein
Species
Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Target Names
ACIAD3168
Target Protein Sequence
MGHYFMLNLLKKLPFYEKTWFQFILFVLRRFEADRCREHAGALTYTTLFAVVPMLTVFLV IISSIKALEPARQQLQQLIYSNFLPKSTIAFDRVLNSFTEKSSNLTVIGILFLFVTTVMM LSTIETAFNRIWRVKETRSGIIGFMRYWTIISLGPIILGSAFVISSTVASMNILSNNFAG YELSGAFILWLISFGLTILGFFILYWTIPNRTVPMYAAIIAACFSAAIFELLKNIFGFAM SNFTSYELVYGAFAAIPIFLLWIFLSWNIVLLGVEVSYALTAFHSDKIQTRHPVLMLLDV LELFYKKQKLGQSVTDLEALDIMGRGEIGRWPSYIELLEKQNLIKRTDKDEYVLVRNLSQ VDFWTFFTALPYPLPLRKDVGNIHPDDEWMQKIGPALIEADDYLAAKLSIPLSTLFEAK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the function of ACIAD3168 compare to other characterized Acinetobacter membrane proteins?

While the specific function of ACIAD3168 is not fully characterized, it shares structural similarities with other Acinetobacter membrane proteins that are better studied. Unlike the well-characterized OmpA (Outer Membrane Protein A) which is known to function in bacterial adhesion, invasion, and biofilm formation, ACIAD3168 belongs to a different protein family (UPF0761).

Research on other Acinetobacter membrane proteins provides a comparative framework:

Membrane ProteinSpeciesKey FunctionsStructural Features
ACIAD3168 (UPF0761)A. sp. strain ADP1Not fully characterizedMultiple transmembrane domains
OmpAA. baumanniiAdhesion, invasion, biofilm formationβ-barrel protein with surface-exposed loops
Omp38/OmpAA. baumanniiVirulence factor, adhesionβ-barrel structure (8-10 strands)
PmrCA. baumanniiLipid A modification, colistin resistancePetN transferase activity

This comparison suggests ACIAD3168 may play a distinct role in membrane structure or function compared to the virulence-associated proteins like OmpA.

What are the optimal conditions for recombinant expression of ACIAD3168?

Based on established protocols for similar Acinetobacter membrane proteins, the following methodological approach is recommended for ACIAD3168 expression:

  • Vector selection: pET expression systems are suitable for membrane protein expression, with pET19b providing a histidine tag for purification purposes.

  • Expression system: While E. coli BL21(DE3) is commonly used, membrane proteins often benefit from specialized strains like C41(DE3) or C43(DE3) designed for toxic or membrane protein expression.

  • Induction conditions:

    • Temperature: 16-20°C (lower temperatures reduce inclusion body formation)

    • IPTG concentration: 0.1-0.5 mM

    • Induction time: 16-20 hours

  • Buffer optimization:

    • Cell lysis: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Addition of mild detergents (0.5-1% n-dodecyl-β-D-maltopyranoside) during extraction

Comparative yields of Acinetobacter membrane proteins using different expression systems:

Expression SystemTemperatureInduction TimeApproximate Yield (mg/L)
E. coli BL21(DE3)37°C4h0.5-1
E. coli BL21(DE3)20°C16h2-4
E. coli C41(DE3)20°C16h3-6
Yeast-based system28°C72h4-8

These conditions are derived from successful expression protocols for similar membrane proteins from Acinetobacter species.

What purification strategy yields the highest purity of functional ACIAD3168 protein?

A multi-step purification approach is recommended for obtaining high-purity functional ACIAD3168:

  • Initial purification: Immobilized Metal Affinity Chromatography (IMAC)

    • Recommended resin: Ni-NTA or TALON

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% appropriate detergent

    • Imidazole gradient: 20-300 mM

  • Secondary purification: Size Exclusion Chromatography (SEC)

    • Column: Superdex 200

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% detergent, 10% glycerol

  • Optimization steps:

    • Maintain temperature at 4°C throughout purification

    • Include protease inhibitors in all buffers

    • Consider detergent screening to identify optimal solubilization conditions

This approach has been successful for similar membrane proteins, yielding purities >90% as confirmed by SDS-PAGE. The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles.

How can I design experiments to investigate the potential role of ACIAD3168 in antimicrobial resistance?

Design a comprehensive experimental approach with the following components:

  • Gene knockout and complementation studies:

    • Generate ACIAD3168 deletion mutants using CRISPR-Cas9 or homologous recombination

    • Create complementation strains expressing wild-type ACIAD3168

    • Include controls with empty vectors

  • Antibiotic susceptibility testing:

    • Compare minimum inhibitory concentrations (MICs) between wild-type, knockout, and complemented strains

    • Test against a panel of antibiotics including polymyxins, β-lactams, and aminoglycosides

    • Follow standardized methods (CLSI or EUCAST guidelines)

  • Membrane integrity assays:

    • Measure membrane permeability using fluorescent dyes (SYTOX Green)

    • Assess membrane potential with DiSC3(5) or DiBAC4(3)

    • Monitor leakage of cellular components (ATP, nucleic acids)

  • Comparative expression analysis:

    • Quantify ACIAD3168 expression levels using qRT-PCR in response to antibiotic exposure

    • Compare with expression patterns of known resistance genes (e.g., pmrC)

Sample experimental design table:

Experiment GroupStrainsAntibiotic ChallengeAnalysis MethodsExpected Outcomes
ControlWild-type Acinetobacter sp.NoneGrowth curves, qRT-PCRBaseline expression and growth
Test Group 1ACIAD3168 knockoutColistin gradientMIC determination, membrane integrityAltered susceptibility if involved in resistance
Test Group 2ACIAD3168 overexpressionColistin gradientMIC determination, membrane integrityEnhanced resistance if protective function
Comparison GroupPmrC knockoutColistin gradientMIC determinationKnown colistin resistance determinant

This approach mirrors successful experimental designs used to characterize the role of PmrC in colistin resistance, which could serve as a methodological template.

What controls should be included when designing experiments to investigate protein-protein interactions involving ACIAD3168?

A robust experimental design for investigating ACIAD3168 protein-protein interactions should include these essential controls:

  • Negative interaction controls:

    • Non-interacting protein pairs (e.g., cytoplasmic protein vs. ACIAD3168)

    • Empty vector/tag-only constructs to control for tag-mediated interactions

    • ACIAD3168 with known membrane proteins from distant bacterial species

  • Positive interaction controls:

    • Well-characterized membrane protein interactions from the same organism

    • Artificially dimerized constructs as technical positive controls

  • Technical validation controls:

    • Input protein quantification prior to interaction assays

    • Expression level verification in co-immunoprecipitation studies

    • Detergent compatibility tests for membrane protein solubilization

  • Methodological variation:

    • Employ multiple interaction detection methods (e.g., co-IP, bacterial two-hybrid, FRET)

    • Test interactions under different physiological conditions (pH, ionic strength)

    • Use both N- and C-terminal tags to account for potential steric hindrance

The experimental framework should draw from established methodologies used in previous studies of Acinetobacter membrane protein interactions, adapting approaches that successfully identified interactions between other membrane components.

How does ACIAD3168 compare structurally and functionally with OmpA proteins from pathogenic Acinetobacter species?

While ACIAD3168 and OmpA are both membrane proteins in Acinetobacter species, they have distinct structural characteristics and likely different functional roles:

FeatureACIAD3168 (UPF0761)OmpA (Acinetobacter baumannii)
Size419 amino acidsTypically 356-360 amino acids
StructureMultiple transmembrane domainsβ-barrel (8-10 strands) with surface loops
DomainsUncharacterized UPF0761 familyBeta-barrel domain (OMP_b-brl) and OmpA-C-like domain
ExpressionNot fully characterizedHighly expressed in virulent strains
FunctionUnknownAdhesion, invasion, biofilm formation, virulence
Clinical significanceNot establishedAssociated with pneumonia, bacteremia, mortality
ConservationLimited data availableHighly conserved (91-100%) across clinical species

OmpA in A. baumannii has been extensively studied and linked to pathogenicity, with clinical studies showing that increased OmpA expression correlates with more severe infections. One study demonstrated that isolates from patients with pneumonia overexpressed ompA compared to isolates from merely colonized patients (ratio 1.76 vs 0.36, P<0.001), and isolates from bacteremic patients showed even higher expression (ratio 2.37 vs 1.43, P=0.06).

In contrast, ACIAD3168 has not been characterized in this clinical context, and its role in virulence or other membrane functions remains to be elucidated.

What bioinformatic approaches can be used to predict potential functions of ACIAD3168 based on structural homology?

A comprehensive bioinformatic workflow for predicting ACIAD3168 function should include:

  • Sequence-based analyses:

    • Position-Specific Iterative BLAST (PSI-BLAST) to identify distant homologs

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Phylogenetic analysis to understand evolutionary relationships

    • Conserved domain analysis using InterProScan or NCBI CDD

  • Structural prediction:

    • Transmembrane topology prediction (TMHMM, TOPCONS)

    • Secondary structure prediction (PSIPRED, JPred)

    • Tertiary structure modeling using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to assess stability

  • Functional inference:

    • Gene neighborhood analysis to identify functional associations

    • Co-expression analysis across different conditions

    • Binding site prediction and comparison with characterized proteins

    • Molecular docking with potential substrates or interacting proteins

This approach mirrors methods used to characterize other membrane proteins such as OmpA and PmrC, which were initially examined through bioinformatic methods before experimental validation.

The successful application of these methods to other Acinetobacter membrane proteins has revealed functional insights - for example, protein topology prediction for OmpA of A. baumannii LI311 identified its characteristic β-barrel structure with 10 β-stranded transmembrane regions and a signal peptide at residues 1-22, which informed subsequent experimental studies.

How can ACIAD3168 be utilized in screening for novel antimicrobial compounds targeting Acinetobacter species?

ACIAD3168 can serve as a target protein in antimicrobial screening assays using the following methodological approach:

  • High-throughput binding assays:

    • Microscale Thermophoresis (MST) to measure direct binding of compounds to purified ACIAD3168

    • Thermal shift assays to detect ligand-induced protein stabilization

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

  • Structure-based virtual screening:

    • Molecular docking against predicted binding pockets in ACIAD3168

    • Pharmacophore modeling based on structural features

    • Fragment-based screening to identify initial chemical scaffolds

  • Functional inhibition assays:

    • Membrane permeability assays in the presence of potential inhibitors

    • Growth inhibition studies with compound combinations

    • Synergy testing with existing antibiotics

This approach has been successfully applied to other Acinetobacter membrane proteins. For example, researchers identified a small molecule (s-Phen) that binds to the PmrC protein with μM affinity through structure-based virtual screening. This compound significantly reduced colistin resistance in A. baumannii clinical isolates, demonstrating the validity of membrane protein-targeted screening approaches.

A systematic screening workflow might include:

  • Initial screening of 10,000-100,000 compounds at a single concentration

  • Dose-response testing of top 100-500 hits

  • Structural optimization of 5-10 lead compounds

  • In-depth characterization of 1-3 optimized leads

What methodologies are most effective for studying ACIAD3168 interactions with antimicrobial peptides?

To investigate ACIAD3168 interactions with antimicrobial peptides (AMPs), implement this multi-faceted experimental approach:

  • In vitro binding assays:

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Fluorescence spectroscopy with labeled peptides

    • Microscale Thermophoresis for binding affinity determination

  • Membrane model systems:

    • Reconstitute ACIAD3168 in liposomes of varying lipid compositions

    • Utilize planar lipid bilayers for electrophysiological measurements

    • Employ supported lipid bilayers for surface-sensitive techniques

  • Structural studies of interactions:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction sites

    • Cryo-electron microscopy of ACIAD3168-peptide complexes

    • NMR studies of labeled peptides interacting with membrane-embedded protein

  • Functional consequences of interaction:

    • Leakage assays using fluorescent dye-loaded liposomes

    • Membrane potential measurements in bacterial cells

    • Antimicrobial susceptibility testing in isogenic strains with varied ACIAD3168 expression

This approach draws inspiration from studies of peptide-membrane protein interactions in other systems, such as the identification of peptide P92 (sequence: QMGFMTSPKHSV) that binds to OmpA in A. baumannii with high affinity (KD value of 7.84 nM). While P92 did not directly inhibit bacterial growth, it significantly reduced bacterial adhesion, invasion, and biofilm formation by targeting OmpA.

Similar methodologies could reveal whether ACIAD3168 interacts with AMPs and what functional consequences these interactions might have for membrane integrity and bacterial survival.

How can I design experiments to investigate the potential role of ACIAD3168 in bacterial membrane stability and integrity?

Design a comprehensive experimental approach using these methodologies:

  • Generation of experimental strains:

    • ACIAD3168 deletion mutant (ΔACIAD3168)

    • Complemented strain (ΔACIAD3168 + pACIAD3168)

    • Overexpression strain (wild-type + pACIAD3168)

    • Control strain (wild-type + empty vector)

  • Membrane stability assessments:

    • Osmotic shock resistance (survival at varying NaCl concentrations)

    • Detergent sensitivity assays (MIC of SDS, Triton X-100)

    • Freeze-thaw cycle tolerance

    • Temperature sensitivity profiling (growth at 25°C, 37°C, 42°C)

  • Membrane permeability measurements:

    • Uptake of hydrophobic compounds (1-N-phenylnaphthylamine)

    • Fluorescent dye leakage (propidium iodide, SYTOX Green)

    • β-lactamase leakage assay for outer membrane integrity

    • Measurement of proton motive force maintenance

  • Membrane composition analysis:

    • Lipid profiling by mass spectrometry

    • Protein:lipid ratio determination

    • Membrane fluidity assessment using fluorescence anisotropy

    • Atomic force microscopy for membrane ultrastructure

  • Response to membrane stress:

    • Transcriptomic analysis under membrane-disrupting conditions

    • Proteomic changes in membrane fraction

    • Real-time monitoring of ACIAD3168 expression using reporter constructs

This experimental design incorporates approaches used to study membrane proteins like PmrC and OmpA, adapting them specifically to investigate ACIAD3168's role in membrane stability.

What are the most effective approaches for identifying and validating potential inhibitors of ACIAD3168?

A systematic approach to identify and validate ACIAD3168 inhibitors should include:

  • Primary screening approaches:

    • Structure-based virtual screening against ACIAD3168 binding pockets

    • Fragment-based screening to identify chemical scaffolds

    • Repurposing screens of approved drugs and known antimicrobials

    • High-throughput biochemical assays if a functional activity is identified

  • Secondary validation assays:

    • Direct binding confirmation (SPR, ITC, MST)

    • Thermal shift assays to assess protein stabilization/destabilization

    • Competition assays with known ligands or substrates

    • Functional assays based on identified protein activity

  • Structural characterization of binding:

    • X-ray crystallography of protein-inhibitor complexes

    • NMR studies of labeled protein with inhibitors

    • Hydrogen-deuterium exchange mass spectrometry

    • Computational modeling and molecular dynamics simulations

  • Biological validation:

    • Growth inhibition in wild-type vs. ACIAD3168-deficient strains

    • Membrane integrity assays in the presence of inhibitors

    • Synergy testing with conventional antibiotics

    • Toxicity assessment in mammalian cell lines

  • Lead optimization strategy:

    • Structure-activity relationship (SAR) studies

    • Medicinal chemistry optimization for potency and selectivity

    • Pharmacokinetic improvement

    • Assessment of resistance development potential

This approach mirrors successful inhibitor identification strategies used for other Acinetobacter membrane proteins. For example, researchers identified inhibitors of PmrC using virtual screening followed by binding confirmation with Microscale Thermophoresis, which led to compounds that could reduce colistin resistance.

What strategies can resolve solubility and stability issues when working with recombinant ACIAD3168?

Membrane proteins like ACIAD3168 present unique challenges that can be addressed with these methodological approaches:

  • Improving solubility during expression:

    • Fusion tags: MBP, SUMO, or Mistic tags enhance membrane protein solubility

    • Expression temperature: Lower to 16-20°C to slow folding and reduce aggregation

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Addition of chemical chaperones to growth media (glycerol, arginine, DMSO)

  • Optimizing extraction and purification:

    • Detergent screening panel (minimum 8-10 detergents of different classes)

    • Detergent concentration optimization (typically 1-5× CMC)

    • Buffer composition screening (pH 6.0-8.5, salt concentration 100-500 mM)

    • Addition of stabilizing lipids (E. coli polar lipids, cholesterol)

  • Enhancing long-term stability:

    • Storage buffer optimization with glycerol (20-50%)

    • Addition of specific lipids identified from native membrane

    • Use of amphipols or nanodiscs for detergent-free storage

    • Flash-freezing in small aliquots to minimize freeze-thaw cycles

  • Functional state preservation:

    • Size-exclusion chromatography to monitor oligomeric state

    • Circular dichroism to verify secondary structure retention

    • Activity assays (if available) to confirm functional preservation

    • Negative-stain electron microscopy to assess structural integrity

When working with ACIAD3168, storage in Tris-based buffer with 50% glycerol at -20°C is recommended for short-term storage, while -80°C is preferable for long-term storage. Working aliquots should be kept at 4°C for up to one week, and repeated freezing and thawing should be avoided.

How can I troubleshoot expression yield issues when working with ACIAD3168?

Low expression yields are common with membrane proteins like ACIAD3168. Address this challenge systematically:

  • Expression system optimization:

    • Strain comparison: Test BL21(DE3), C41(DE3), C43(DE3), and Lemo21(DE3)

    • Vector selection: Compare T7, tac, and arabinose-inducible promoters

    • Codon optimization: Align codons to match expression host preferences

    • Signal sequence optimization or removal

  • Induction protocol refinement:

    • IPTG concentration titration (0.01-1.0 mM)

    • Auto-induction media formulation

    • Induction at different growth phases (early, mid, late log)

    • Extended expression times at lower temperatures (16-20°C for 16-24h)

  • Growth media modifications:

    • Testing rich vs. minimal media

    • Supplementation with specific ions (Mg2+, Ca2+, Zn2+)

    • Addition of membrane components (phospholipids, cholesterol)

    • Osmotic stress modulators (betaine, sucrose)

  • Expression monitoring:

    • Time-course sampling to determine optimal harvest time

    • Fractionation to detect protein in different cellular compartments

    • Western blot analysis to detect even low expression levels

    • GFP-fusion constructs for real-time expression monitoring

A structured troubleshooting approach might include:

ParameterInitial ConditionModification 1Modification 2Modification 3
Host strainBL21(DE3)C41(DE3)C43(DE3)Lemo21(DE3)
Temperature37°C30°C25°C18°C
IPTG1.0 mM0.5 mM0.1 mM0.05 mM
MediaLBTB2×YTAuto-induction
AdditivesNone0.5M sorbitol1% glucose10% glycerol

This systematic approach to expression optimization has been successfully applied to challenging membrane proteins similar to ACIAD3168.

What are the potential applications of ACIAD3168 in developing targeted therapies against Acinetobacter infections?

While ACIAD3168's specific function remains to be fully characterized, research on other Acinetobacter membrane proteins suggests several potential therapeutic applications:

  • Vaccine development approaches:

    • Peptide vaccines targeting conserved epitopes of ACIAD3168

    • Recombinant protein-based vaccines with appropriate adjuvants

    • DNA vaccines encoding immunogenic regions

    • Outer membrane vesicle (OMV)-based vaccines including ACIAD3168

  • Targeted drug delivery systems:

    • ACIAD3168-specific antibodies conjugated to antimicrobials

    • Aptamers targeting unique structural features

    • Nanobodies for enhanced penetration of bacterial biofilms

    • Phage-derived proteins that recognize ACIAD3168

  • Novel antimicrobial strategies:

    • Small molecule inhibitors of ACIAD3168 function

    • Peptide mimetics that disrupt protein-protein interactions

    • Antimicrobial peptides targeting ACIAD3168-dependent processes

    • Combination therapies targeting multiple membrane proteins

  • Diagnostic applications:

    • ACIAD3168-based biomarkers for infection detection

    • Point-of-care diagnostics using anti-ACIAD3168 antibodies

    • Species-specific identification based on sequence variations

These approaches are informed by successful strategies targeting other Acinetobacter membrane proteins. For instance, OmpA has been explored as a vaccine target, with studies showing that recombinant OmpA can induce protective immunity. Similarly, the peptide P92 targeting OmpA demonstrated therapeutic efficacy in various infection models.

The development of these applications would require further characterization of ACIAD3168's role in bacterial physiology and pathogenesis, following experimental approaches similar to those used for OmpA and PmrC.

What are the key areas for future research regarding ACIAD3168 and its potential role in Acinetobacter biology?

Future research on ACIAD3168 should focus on these priority areas:

  • Functional characterization:

    • Gene knockout studies to determine essentiality and phenotypic effects

    • Interactome mapping to identify protein-protein interactions

    • Transcriptional regulation under various environmental conditions

    • Structure-function relationship studies using mutagenesis

  • Structural biology:

    • High-resolution structure determination (X-ray crystallography, cryo-EM)

    • Membrane topology validation using experimental approaches

    • Conformational dynamics using hydrogen-deuterium exchange or FRET

    • Ligand binding site identification

  • Comparative genomics and evolution:

    • Distribution and conservation across Acinetobacter species

    • Evolutionary history and selection pressures

    • Horizontal gene transfer and recombination events

    • Correlation with habitat adaptation or virulence potential

  • Translational research:

    • Evaluation as a potential diagnostic biomarker

    • Assessment as a drug target or vaccine candidate

    • Investigation of role in antimicrobial resistance mechanisms

    • Development of inhibitors or modulators of activity

  • Systems biology approaches:

    • Integration into metabolic and regulatory networks

    • Multi-omics profiling in response to ACIAD3168 perturbation

    • Machine learning applications for prediction of functional partners

    • Pathway modeling incorporating ACIAD3168 interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.