Recombinant Acomys wilsoni Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acomys wilsoni Cytochrome c oxidase subunit 2 (MT-CO2)

Recombinant Acomys wilsoni Cytochrome c oxidase subunit 2, also known as MT-CO2, is a recombinant protein derived from the Wilson's spiny mouse (Acomys wilsoni). This protein is a crucial component of the cytochrome c oxidase complex, which plays a pivotal role in the electron transport chain within mitochondria, facilitating the process of oxidative phosphorylation. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its use in various biochemical and biomedical research applications.

Structure and Function

Cytochrome c oxidase subunit 2 (MT-CO2) is encoded by the MT-CO2 gene and is part of the mitochondrial genome. It is involved in the transfer of electrons from cytochrome c to oxygen, ultimately producing water and generating a proton gradient across the mitochondrial inner membrane. This gradient is essential for ATP synthesis, providing energy for cellular processes.

CharacteristicsDescription
SpeciesAcomys wilsoni (Wilson's spiny mouse)
Protein TypeRecombinant Protein
FunctionElectron transport chain component
Gene NameMT-CO2
Alternative NamesCytochrome c oxidase polypeptide II, COII, COXII, MTCO2

Production and Availability

The recombinant Acomys wilsoni Cytochrome c oxidase subunit 2 is available in quantities of 50 µg, with other quantities available upon request. It is produced using recombinant DNA technology and is stored in a Tris-based buffer with 50% glycerol to maintain stability. The protein is typically stored at -20°C for short-term use and at -80°C for long-term storage. Repeated freezing and thawing should be avoided to preserve protein integrity .

Acomys wilsoni as a Research Model

Acomys wilsoni and other spiny mice have gained attention for their remarkable regenerative abilities, including scarless wound healing and potential for CNS regeneration . While MT-CO2 itself is not directly linked to these regenerative processes, studying its function in the context of Acomys' metabolism could provide insights into how these animals maintain energy homeostasis during regeneration.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Acomys wilsoni (Wilson's spiny mouse)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISSMLATKMTHTSTMDAQS METIWTILPAVILVLIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMVPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKFFENWSASMI
Uniprot No.

Target Background

Function
Recombinant *Acomys wilsoni* Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-CO2 in cellular respiration?

MT-CO2 (mitochondrially encoded cytochrome c oxidase subunit 2) serves as a critical component of the respiratory chain that catalyzes the reduction of oxygen to water. It forms part of complex IV, with subunits 1-3 constituting the functional core of the enzyme complex. The primary role of subunit 2 is to transfer electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 . This electron transfer function is essential for maintaining the proton gradient across the inner mitochondrial membrane that drives ATP synthesis, making MT-CO2 central to cellular energy production.

How does Acomys wilsoni MT-CO2 differ from other mammalian species?

While specific sequence variations of Acomys wilsoni MT-CO2 aren't detailed in the provided references, research on spiny mice (Acomys) indicates they possess distinctive respiratory physiology compared to common laboratory mice. Spiny mice demonstrate different breathing patterns and CO2 production rates, particularly notable in their response to hypoxic conditions. During extended hypoxia, both male and female spiny mice decrease CO2 production and tidal volume to a greater degree than C57BL/6 laboratory mice . These physiological differences likely reflect adaptation to their desert habitat and may correlate with structural or functional variations in respiratory proteins including MT-CO2.

What expression systems are most effective for producing recombinant Acomys wilsoni MT-CO2?

For successful recombinant expression of mitochondrial membrane proteins like MT-CO2, Escherichia coli remains a primary expression system due to its rapid growth, high yields, and genetic tractability. Based on recent successful approaches with similar mitochondrial proteins, the most effective strategy involves:

  • Codon optimization for E. coli expression

  • Fusion with solubility-enhancing tags (e.g., MBP, SUMO)

  • Expression under control of an inducible promoter system (e.g., T7 promoter with IPTG induction)

  • Growth at lower temperatures (16-25°C) after induction to facilitate proper folding

  • Inclusion of specific chaperones to assist with membrane protein folding

Alternative expression systems including yeast (Pichia pastoris) and mammalian cell lines may yield protein with more native-like post-translational modifications when required for functional studies.

How can recombinant Acomys wilsoni MT-CO2 be used to study the species' unique hypoxia tolerance mechanisms?

Spiny mice demonstrate remarkable hypoxia tolerance compared to standard laboratory mice. During prolonged hypoxia exposure (30 min), Acomys exhibits a more pronounced decrease in CO2 production than C57BL/6 mice, especially after 20-30 minutes of exposure, indicating a significant metabolic depression strategy . To investigate the molecular basis of this adaptation:

  • Generate recombinant wild-type and mutated versions of Acomys MT-CO2

  • Compare enzyme kinetics with recombinant MT-CO2 from hypoxia-sensitive species

  • Perform oxygen consumption assays under varying oxygen concentrations

  • Conduct site-directed mutagenesis to identify specific amino acid residues responsible for altered function

  • Use reconstitution experiments in proteoliposomes to measure proton pumping efficiency

What are the optimal conditions for assessing electron transfer activity of reconstituted recombinant Acomys wilsoni MT-CO2?

Assessing the electron transfer activity of recombinant MT-CO2 requires careful experimental design. The optimal protocol involves:

  • Incorporation of purified recombinant MT-CO2 into liposomes with appropriate lipid composition mimicking the mitochondrial inner membrane

  • Temperature control at 37°C (physiological) with comparative measurements at 25°C and 42°C to assess thermal stability

  • Buffer conditions: pH 7.2-7.4 with physiological ionic strength

  • Substrate concentrations:

    • Reduced cytochrome c: 0.1-100 μM (for Km determination)

    • Oxygen: measurements under varying concentrations (1-21%)

  • Measurement techniques:

    • Spectrophotometric monitoring of cytochrome c oxidation at 550 nm

    • Oxygen consumption using Clark-type electrode

    • Stopped-flow rapid kinetics for transient state measurements

ParameterOptimal RangeNotes
pH7.2-7.4Physiological range
Temperature37°CAlso measure at 25°C and 42°C for thermal profile
Cytochrome c0.1-100 μMFor kinetic parameter determination
Oxygen1-21%Compare activity at varied concentrations
Ionic strength150 mM KClPhysiological condition
Detergent0.01-0.05% DDMFor stabilization if not in liposomes

How do mutations in Acomys wilsoni MT-CO2 affect its interaction with other respiratory complex components?

To investigate the impact of mutations on protein-protein interactions within the respiratory complex:

  • Generate a panel of recombinant MT-CO2 variants with point mutations at conserved and species-specific residues

  • Perform co-immunoprecipitation studies with other respiratory complex subunits

  • Utilize surface plasmon resonance (SPR) to quantify binding affinities

  • Conduct crosslinking mass spectrometry (XL-MS) to map interaction interfaces

  • Employ blue native PAGE to assess complex assembly efficiency

This systematic approach would identify critical residues and provide insights into how species-specific variations in MT-CO2 influence respiratory complex formation and stability under different physiological conditions.

What purification strategy yields highest activity for recombinant Acomys wilsoni MT-CO2?

For optimal purification of recombinant Acomys wilsoni MT-CO2 while preserving enzymatic activity:

  • Membrane fraction isolation:

    • Lyse cells expressing recombinant MT-CO2 using either sonication or pressure homogenization

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Use mild detergents (0.5-1% n-dodecyl β-D-maltoside) in buffer containing 20 mM HEPES pH 7.4, 300 mM NaCl

    • Include 10% glycerol as stabilizer

    • Solubilize at 4°C for 1-2 hours with gentle agitation

  • Chromatography steps:

    • Immobilized metal affinity chromatography (if His-tagged)

    • Ion exchange chromatography (typically anion exchange)

    • Size exclusion chromatography for final polishing

  • Activity preservation:

    • Maintain 0.05% detergent throughout to prevent aggregation

    • Include copper supplement (CuSO₄, 10 μM) to ensure cofactor incorporation

    • Store with reducing agent (2 mM DTT) to protect thiol groups

This approach typically yields protein with >90% purity and preserved catalytic activity, suitable for structural and functional studies.

How can researchers effectively reconstitute recombinant Acomys wilsoni MT-CO2 into functional models for respiratory research?

Reconstitution of functional MT-CO2 into experimental systems requires careful consideration of the protein environment. Based on successful approaches with similar proteins, the following methodology is recommended:

  • Proteoliposome preparation:

    • Mix purified MT-CO2 with phospholipids (70% phosphatidylcholine, 20% phosphatidylethanolamine, 10% cardiolipin) in detergent

    • Remove detergent via dialysis or Bio-Beads over 24-48 hours

    • Confirm successful incorporation via freeze-fracture electron microscopy

  • Whole-cell biohybrid systems:

    • Following methodology similar to E. coli biohybrids described for CO2 reduction

    • Engineer E. coli to express full or partial Acomys respiratory components

    • Measure respiratory parameters under varying conditions

  • In vitro functional reconstitution:

    • Combine purified MT-CO2 with other respiratory complex subunits

    • Verify complex assembly via blue native PAGE

    • Measure electron transfer rates in the reconstituted system

  • Verification methods:

    • Oxygen consumption measurements

    • Membrane potential monitoring using voltage-sensitive dyes

    • ATP synthesis quantification

Each approach offers different advantages, with proteoliposomes providing a controlled environment for mechanistic studies and whole-cell systems allowing investigation of integrated respiratory function.

How does the catalytic efficiency of Acomys wilsoni MT-CO2 compare with that of other mammalian species under varying oxygen conditions?

The unique respiratory adaptations observed in spiny mice suggest potentially distinctive properties of their respiratory proteins. To systematically compare MT-CO2 catalytic properties:

  • Express and purify recombinant MT-CO2 from:

    • Acomys wilsoni (spiny mouse)

    • Mus musculus (laboratory mouse)

    • Rattus norvegicus (rat)

    • Homo sapiens (human)

  • Conduct enzyme kinetic assays under identical conditions:

    • Normoxia (21% O₂)

    • Moderate hypoxia (10% O₂)

    • Severe hypoxia (5% O₂)

    • Hyperoxia (40% O₂)

  • Determine and compare the following parameters:

SpeciesConditionKm for cytochrome c (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Oxygen affinity (μM)
A. wilsoniNormoxia[To be determined][TBD][TBD][TBD]
A. wilsoniHypoxia (10%)[Expected to be lower][TBD][TBD][Expected to be higher]
M. musculusNormoxia[Reference values][Reference][Reference][Reference]
M. musculusHypoxia (10%)[Reference values][Reference][Reference][Reference]

Based on the physiological data showing greater hypoxia tolerance in spiny mice , researchers would hypothesize that Acomys MT-CO2 maintains better catalytic efficiency under low oxygen conditions, potentially through structural adaptations that increase oxygen binding affinity.

What structural features distinguish Acomys wilsoni MT-CO2 from other mammalian homologs?

To elucidate the structural basis for potential functional differences:

  • Generate high-resolution structural data using:

    • X-ray crystallography (if crystals can be obtained)

    • Cryo-electron microscopy (preferred for membrane proteins)

    • NMR for specific domains or interactions

  • Analyze key structural features:

    • Copper binding site architecture

    • Transmembrane domain organization

    • Interface with other complex IV subunits

    • Species-specific amino acid substitutions, particularly in:

      • Catalytic regions

      • Oxygen binding channel

      • Proton transfer pathways

  • Conduct molecular dynamics simulations to examine:

    • Protein flexibility under different oxygen concentrations

    • Water molecule organization in proton channels

    • Conformational changes during catalytic cycle

By correlating structural differences with functional parameters, researchers can identify adaptations that contribute to the unique respiratory characteristics observed in Acomys species.

How can recombinant Acomys wilsoni MT-CO2 inform research on mitochondrial disorders?

MT-CO2 is associated with mitochondrial disorders including MELAS syndrome (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes) . Recombinant Acomys wilsoni MT-CO2 can advance research in this area through:

  • Comparative mutational analysis:

    • Create disease-associated mutations in recombinant Acomys MT-CO2

    • Compare functional impact with identical mutations in human MT-CO2

    • Identify whether Acomys-specific features provide any protective effects

  • Investigation of hypoxia tolerance mechanisms:

    • Many mitochondrial disorder symptoms worsen during metabolic stress

    • Acomys species demonstrate superior hypoxia tolerance

    • Determine if MT-CO2 contributes to this tolerance through:

      • Enhanced electron transfer efficiency under stress

      • Reduced reactive oxygen species production

      • Altered interaction with other respiratory components

  • Therapeutic strategy development:

    • Identify compensatory mutations that restore function in disease variants

    • Explore the potential of gene therapy approaches using hybrid proteins

    • Develop screening assays for compounds that improve MT-CO2 function

What insights can recombinant Acomys wilsoni MT-CO2 provide for research on metabolic adaptations to environmental stress?

Acomys species have evolved in desert environments, developing adaptations to metabolic challenges. Research with recombinant MT-CO2 can reveal:

  • Metabolic efficiency adaptations:

    • Compare oxygen consumption rates and ATP production efficiency between species

    • Measure performance under varying temperature conditions (15-42°C)

    • Assess functioning during simulated dehydration stress

  • Respiratory responses to environmental changes:

    • Female spiny mice exhibit lower tidal volumes and CO₂ production compared to C57BL/6 mice

    • Investigate whether sex-specific differences in MT-CO2 function contribute to these observations

    • Examine post-translational modifications under different environmental conditions

  • Experimental approach:

    • Generate sex-specific recombinant MT-CO2 variants from male and female Acomys

    • Quantify functional parameters in reconstituted systems

    • Correlate molecular findings with whole-animal physiological data

These studies could identify molecular mechanisms that enable survival in extreme environments, with potential applications for improving metabolic efficiency and stress resistance.

How can CRISPR-Cas9 technology be used to study Acomys wilsoni MT-CO2 function in cellular models?

CRISPR-Cas9 technology offers powerful approaches for investigating MT-CO2 function:

  • Heterologous expression system development:

    • Use CRISPR to replace mouse or human MT-CO2 genes with Acomys wilsoni variants

    • Create cellular models expressing chimeric proteins with domain swaps

    • Develop inducible expression systems for temporal control

  • Methodological approach:

    • Design guide RNAs targeting mitochondrial DNA (challenging but feasible)

    • Utilize mitochondrially-targeted Cas9 for precise editing

    • Employ homology-directed repair to insert Acomys sequences

    • Verify mitochondrial DNA modifications using next-generation sequencing

  • Functional assessment:

    • Measure respiratory parameters in modified cells

    • Compare performance under normal and stress conditions

    • Analyze cellular adaptations to the introduced Acomys MT-CO2

These genetic engineering approaches would enable direct investigation of how species-specific MT-CO2 variants function within the cellular context of different mammalian backgrounds.

What are the challenges and solutions for studying the interaction between recombinant Acomys wilsoni MT-CO2 and nuclear-encoded respiratory complex subunits?

Studying interactions between mitochondrially-encoded MT-CO2 and nuclear-encoded subunits presents unique challenges:

This research would provide fundamental insights into mitochondrial-nuclear genomic co-evolution and the molecular basis for respiratory complex assembly across species.

What are the most promising future research directions for Acomys wilsoni MT-CO2?

Based on current knowledge and technological capabilities, the most promising research directions include:

  • Comparative functional genomics:

    • Complete characterization of MT-CO2 variants across Acomys species

    • Correlation with habitat-specific adaptations

    • Identification of convergent evolution patterns in other desert-adapted mammals

  • Therapeutic applications:

    • Development of biomimetic respiratory proteins based on Acomys-specific adaptations

    • Investigation of hypoxia tolerance mechanisms for application in ischemic conditions

    • Exploration of potential protective mechanisms against reactive oxygen species damage

  • Biotechnological applications:

    • Engineering of efficient electron transport systems for bioenergy applications

    • Development of biosensors based on MT-CO2 oxygen sensitivity

    • Creation of biohybrid systems for CO₂ capture applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.