Recombinant Acorus americanus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Acorus americanus Chloroplast Envelope Membrane Protein (cemA) is a genetically engineered version of the native protein encoded by the cemA gene. Native cemA is a heme-binding protein localized to the inner chloroplast envelope membrane, playing roles in chloroplast biogenesis and redox processes . Recombinant production allows for scalable synthesis in heterologous systems, typically Escherichia coli, to study its structure, function, and potential applications in plant biology or biotechnology .

Production and Purification

Recombinant cemA is produced via bacterial expression systems, with the following key parameters:

ParameterDetailsSource
Expression HostEscherichia coli
TagN-terminal His-tag (for purification via affinity chromatography)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol addition

The protein’s full-length sequence (1–229 amino acids) is preserved, with a calculated molecular weight of ~26 kDa .

Comparative Analysis

FeatureAcorus americanus cemAOryza sativa cemA
UniProt IDA9LYB2P0C302
TagHis-tagHis-tag
Expression SystemE. coliE. coli
Purity>90%>90%
ApplicationsStructural studiesSDS-PAGE, ELISA

Data adapted from .

Antibody Development

Recombinant cemA serves as an antigen for generating specific antibodies, enabling:

  • Immunoblotting: Detection of native cemA in A. americanus chloroplasts .

  • ELISA Kits: Quantification of cemA levels in experimental systems (e.g., stress response studies) .

Functional Studies

  • Heme-Binding Assays: Recombinant cemA can be used to study heme-protein interactions in vitro .

  • Chloroplast Membrane Dynamics: Insights into protein import and membrane stability under environmental stress .

Challenges and Future Directions

  • Translational Uncertainty: While cemA mRNA is detected, evidence for functional protein synthesis in A. americanus remains limited .

  • Phylogenetic Utility: cemA orthologs in monocots (e.g., rice) show conserved motifs but divergent regulatory regions, warranting comparative genomic studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Acorus americanus (Sweetflag) (Acorus calamus var. americanus)
Target Names
cemA
Target Protein Sequence
MPKKKGFTPLPYLASIVFLPWWVSLSFNKSLEPWVTNWWNTRQSETFLNDIQERNVLERF IELEELFLLDEMLKENPETRMKNLRIGIHNETIQLVKTDNEYHLHTILHFSTNIICFAIL SVYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLVTDLWIGFHSPHGWELMIGSVYND FGLAHNEQIISGLVSTFPVILDTIVKYWIFHYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How does the genomic structure of cemA in Acorus americanus compare to other monocots?

The genomic structure of cemA in Acorus americanus should be analyzed within the context of the genus's evolutionary position as sister to all other monocots . Phylogenetic analyses based on both chloroplast and nuclear genes consistently support that Acorus is the sister lineage to remaining monocots .

Methodology for comparative genomic analysis:

  • Extract high-molecular-weight DNA following protocols similar to those used for A. gramineus genome sequencing

  • Utilize both short-read (Illumina) and long-read (PacBio HiFi or Nanopore) sequencing for accurate assembly

  • Apply BUSCO assessment for completeness evaluation

  • Perform comparative analysis against other monocot genomes

Unlike most monocot clades, Acorus did not experience the tau (τ) whole-genome duplication event, which has significant implications for gene copy number and potential functional divergence of cemA . This makes Acorus an excellent model for understanding the ancestral state of chloroplast envelope proteins in early monocots.

What techniques are most effective for localizing cemA within chloroplast envelope membranes?

The precise localization of cemA within the inner or outer chloroplast envelope membrane requires rigorous subcellular fractionation approaches:

TechniqueAdvantagesLimitationsApplication to cemA
Chloroplast envelope fractionationSeparates inner and outer membranesLabor-intensiveEssential for membrane-specific localization
Immunogold electron microscopyDirect visualization of protein locationRequires specific antibodiesPrecise localization within membrane structures
Fluorescent protein taggingIn vivo visualizationMay affect protein functionDynamic localization studies
Proteomics of purified fractionsHigh-throughput identificationCross-contamination concernsIdentification in membrane fraction context

Based on chloroplast envelope proteome studies, researchers should implement the following methodology:

  • Isolate intact chloroplasts using Percoll gradient centrifugation

  • Conduct hypertonic/hypotonic treatments to separate envelope membranes

  • Verify fraction purity via Western blotting with known markers

  • Analyze membrane fractions using mass spectrometry approaches

Note that purity assessment is critical, as "the analysis of membrane fractions remains difficult, in that the dissection of the proteomes of the envelope membranes of chloroplasts or mitochondria is often not reliable because sample purity is not always warranted" .

What expression systems are optimal for producing recombinant Acorus americanus cemA protein?

The selection of an appropriate expression system for recombinant cemA production must consider the membrane-bound nature of this protein:

Expression SystemSuitabilityKey ConsiderationsOptimization Strategy
E. coliModerateLacks chloroplast-specific chaperonesUse C41/C43 strains specialized for membrane proteins
Plant-based systemsHighNatural folding environmentTransient expression in N. benthamiana
Insect cellsGoodBetter for eukaryotic membrane proteinsBaculovirus expression vector system
Cell-free systemsVariableAllows addition of lipids/detergentsSupplement with chloroplast membrane mimetics

Methodology recommendation:

  • Clone the cemA coding sequence from A. americanus chloroplast DNA

  • Design constructs with affinity tags (His, Strep) for purification

  • For E. coli expression, use membrane protein-specific vectors with regulatable promoters

  • Supplement growth media with specific lipids to support proper folding

  • Optimize extraction using mild detergents (DDM, LMNG) to maintain native conformation

Based on comparable studies of chloroplast envelope proteins, researchers should initially attempt heterologous expression in plant systems to preserve functionally critical post-translational modifications .

What purification challenges are specific to recombinant cemA and how can they be addressed?

Purification of recombinant cemA presents several challenges due to its hydrophobic membrane-embedded domains:

  • Solubilization strategy:

    • Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Test solubilization efficiency through Western blotting

    • Consider styrene-maleic acid lipid particles (SMALPs) for native membrane environment preservation

  • Chromatography approach:

    • Initial capture: immobilized metal affinity chromatography (IMAC)

    • Secondary purification: size exclusion chromatography in detergent-containing buffers

    • Quality assessment: compare migration patterns under native and denaturing conditions

  • Stability considerations:

    • Incorporate lipids from chloroplast membranes during purification

    • Test protein stability in various buffer compositions (pH, salt concentration)

    • Use thermal shift assays to identify stabilizing conditions

This workflow draws on general membrane protein purification principles since "the analysis of membrane fractions remains difficult" according to proteomics studies of chloroplast envelopes .

How should researchers design experiments to study cemA function in vivo?

In vivo functional characterization of cemA requires multifaceted approaches:

  • Genetic approaches:

    • CRISPR/Cas9-mediated knockout or knockdown in model species

    • Complementation studies using the A. americanus cemA in mutant lines

    • Site-directed mutagenesis of conserved residues

  • Physiological measurements:

    • CO₂ uptake assays in wild-type versus modified plants

    • Chloroplast integrity assessment under various stress conditions

    • Proton flux measurements across isolated chloroplast membranes

  • Interaction studies:

    • Co-immunoprecipitation with potential binding partners

    • Yeast two-hybrid or split-GFP assays for protein-protein interactions

    • Lipidomics to identify specific lipid interactions important for function

These approaches should consider the evolutionary position of Acorus as an early diverging monocot that "did not experience tau (τ) whole-genome duplication, unlike majority of monocot clades" , which may affect functional redundancy compared to other plant systems.

What techniques are most appropriate for analyzing cemA protein-protein interactions in chloroplast envelopes?

Protein-protein interaction analysis for membrane-embedded proteins like cemA requires specialized techniques:

TechniquePrincipleAdvantages for cemA ResearchLimitations
Chemical cross-linking coupled with MSCovalently links interacting proteinsWorks in native membrane environmentMay capture transient interactions
Co-immunoprecipitationPulls down protein complexesPreserves physiological interactionsRequires effective antibodies
FRET/BRETEnergy transfer between fluorophoresLive cell visualizationMay require protein tagging
Membrane yeast two-hybridModified Y2H for membrane proteinsScreens many potential interactorsArtificial membrane environment
BioID/TurboIDProximity-based labelingIdentifies weak/transient interactionsPotential false positives

Methodology recommendation:

  • Generate epitope-tagged cemA constructs for expression in plant systems

  • Use gentle solubilization conditions to preserve protein complexes

  • Apply at least two complementary techniques to confirm interactions

  • Validate key interactions through functional studies

Research should be guided by findings from chloroplast envelope proteome studies, which have identified numerous proteins but often with "differences concerning the predicted localizations in the independent studies which point toward a possible membrane-association or a possible dual or multi-sublocalization inside the chloroplast or cell" .

How does the structure and function of cemA in Acorus americanus inform our understanding of early monocot evolution?

The study of cemA in Acorus americanus provides unique evolutionary insights due to the genus's position as the sister lineage to all other monocots:

  • Evolutionary context:

    • Phylogenetic analyses consistently place Acorus as "the sister to the remaining monocots"

    • Acorus represents an early diverging lineage that retained ancestral characteristics

  • Genomic architecture:

    • Unlike other monocots, Acorus "did not experience tau (τ) whole-genome duplication"

    • This absence of duplication affects gene copy number and potential neofunctionalization

  • Methodological approach for evolutionary analysis:

    • Sequence cemA from multiple Acorus species and other early-diverging monocots

    • Reconstruct phylogenetic trees using maximum likelihood and Bayesian inference

    • Calculate selection pressure (dN/dS) across different domains of the protein

    • Compare sequence conservation patterns in functional domains

The mitochondrial genome of Acorus exhibits "many genes with higher mutation rates than that of most angiosperms" . Researchers should investigate whether a similar pattern exists for chloroplast genes, including cemA, which could affect protein function and evolutionary rate.

What role might cemA play in the adaptation of Acorus species to wetland environments?

Acorus species, including A. americanus, primarily inhabit wetland environments, suggesting potential adaptive roles for chloroplast membrane proteins:

  • Environmental adaptation hypothesis:

    • cemA may contribute to stress tolerance in fluctuating water conditions

    • Potential roles in maintaining chloroplast integrity during oxygen limitation

  • Experimental approaches to test adaptive significance:

    • Compare cemA sequence/structure between wetland and non-wetland monocots

    • Conduct controlled stress experiments (submergence, hypoxia) measuring cemA expression

    • Test transgenic plants with modified cemA under simulated wetland conditions

  • Ecological context:

    • A. americanus "prefers full sun to part shade and grows in or near water and sometimes grows in mucky ground that is not inundated"

    • It functions in water filtration, as "We like to use calamus between ponds in waterways, as it filters and cleanses the water that runs through it"

This ecological specialization may be reflected in chloroplast envelope protein adaptations that could be investigated through comparative physiological studies and gene expression analysis under controlled environmental conditions.

How can researchers address contradictory findings regarding cemA localization or function across different studies?

Contradictory findings in membrane protein research are common and require systematic approaches to resolution:

  • Source of contradictions:

    • Methodological differences in membrane fractionation

    • Species-specific variations in protein localization

    • Antibody cross-reactivity issues

    • Different experimental conditions affecting protein behavior

  • Resolution strategy:

    • Standardize protein isolation protocols across research groups

    • Use multiple complementary localization techniques

    • Conduct controlled inter-laboratory validation studies

    • Distinguish between primary protein function and secondary effects

  • Methodological harmonization approach:

    • Create a detailed protocol repository specific to cemA research

    • Establish reference standards for antibodies and recombinant proteins

    • Document experimental conditions thoroughly in publications

    • Consider environmental factors affecting protein expression

These challenges are reflected in the chloroplast envelope proteome literature, which notes "differences concerning the predicted localizations in the independent studies which point toward a possible membrane-association or a possible dual or multi-sublocalization inside the chloroplast or cell" .

What are the latest bioinformatic approaches for analyzing cemA sequence data across different Acorus species?

Modern bioinformatic analysis of cemA requires sophisticated computational approaches:

Analysis TypeTools/MethodsApplication to cemA ResearchOutput Interpretation
Sequence homology modelingAlphaFold2, RoseTTAFoldPredict 3D structure of cemAIdentify functional domains
Molecular dynamicsGROMACS, NAMDSimulate cemA in membrane environmentProtein-lipid interactions
Coevolution analysisEVcouplings, DeepSequenceIdentify co-evolving residuesFunctional constraints
Comparative genomicsOrthoFinder, CAFEAnalyze gene family evolutionDuplication/loss patterns
Transcriptome analysisDESeq2, edgeRCompare expression across conditionsRegulatory mechanisms

Methodology recommendation:

  • Assemble high-quality sequence data from multiple Acorus species

  • Implement rigorous alignment curation to account for indels

  • Apply both site and branch-site models of molecular evolution

  • Integrate structural predictions with evolutionary analyses

  • Consider environmental adaptations when interpreting selection signatures

These approaches should build on the genomic resources developed for Acorus species, such as the "high-quality, gap-free genome assembly using ~47.6 Gb of Nanopore long reads, ~20.0 Gb of Nanopore ultra-long reads, ~35.3 Gb of PacBio HiFi reads" developed for A. gramineus .

How should researchers design experiments to test the functional relationship between cemA and other chloroplast envelope proteins?

Testing functional relationships between cemA and other envelope proteins requires integrated experimental design:

  • Interaction mapping strategy:

    • Co-immunoprecipitation with cemA-specific antibodies

    • Proximity labeling (BioID/TurboID) fused to cemA

    • Crosslinking mass spectrometry to identify interacting partners

    • Comparative analysis with "core envelope proteome" identified across species

  • Functional characterization approach:

    • Co-expression analysis using RNA-seq data from multiple tissues

    • Phenotypic comparison of single and double mutants

    • Complementation studies with mutated interaction domains

    • Physiological assays measuring specific functions (e.g., ion transport)

  • Data integration framework:

    • Correlate interaction strength with functional impact

    • Map interactions to specific domains or motifs

    • Consider evolutionary conservation of interactions

    • Develop predictive models of envelope protein networks

These approaches should build on previous envelope proteome studies that have identified "39 proteins were genuine envelope proteins found in at least two species" and defined "the core envelope proteome of chloroplasts" .

What controls and validations are essential when working with recombinant cemA protein?

Rigorous controls are essential for reliable recombinant cemA research:

  • Expression and purification controls:

    • Empty vector negative controls processed identically

    • Multiple purification tags (N-terminal vs. C-terminal) to assess impact on function

    • Inclusion of known chloroplast envelope protein controls

    • Batch-to-batch consistency assessment

  • Functional validation approaches:

    • Circular dichroism to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Reconstitution in liposomes to test membrane integration

    • Activity assays comparing native and recombinant protein

  • Quality control metrics:

    • Size-exclusion chromatography profiles

    • Thermal stability measurements

    • Mass spectrometry verification of post-translational modifications

    • Electron microscopy of membrane-reconstituted protein

These controls address the general challenges in chloroplast envelope protein research, where "proteomic studies are often restricted to single (model) species, and therefore limited in respect to differential individual evolution" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.