Recombinant Acorus americanus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

General Information

Acorus americanus is a plant species, and NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a component of its photosynthetic machinery. The "recombinant" form indicates that the protein has been produced using recombinant DNA technology, typically in a host organism like E. coli .

Table 1: General Information

PropertyDescription
Source OrganismAcorus americanus
Protein TypeNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Recombinant Expression HostE. coli
TagN-terminal His tag
FunctionPart of the NAD(P)H quinone oxidoreductase complex, likely involved in redox reactions in the chloroplast

Function and Mechanism

NAD(P)H quinone oxidoreductases (NQOs) are a class of enzymes that catalyze the two-electron reduction of quinones to hydroquinones, utilizing NAD(P)H as a cofactor . This reaction is crucial for:

  • Detoxification of quinones: Quinones are cytotoxic compounds produced by various organisms, and their reduction to less toxic hydroquinones is an important detoxification mechanism .

  • Redox balancing in chloroplasts: In chloroplasts, NQOs may participate in electron transport chains and redox homeostasis .

The general reaction catalyzed by NAD(P)H quinone oxidoreductases is:

$\~\$
$$
\text{Quinone} + \text{NAD(P)H} + \text{H}^+ \rightarrow \text{Hydroquinone} + \text{NAD(P)}^+
$$
$\~\$

Substrate Specificity

Different NAD(P)H quinone oxidoreductases exhibit varying substrate specificities. Some enzymes prefer benzoquinones, while others favor naphthoquinones . This substrate specificity is influenced by the structure of the active site and the redox potential of the FMN group within the enzyme .

Potential Applications

Due to their role in redox reactions and quinone detoxification, NAD(P)H quinone oxidoreductases and their recombinant forms have potential applications in:

  • Bioremediation: Detoxifying contaminated environments by reducing harmful quinones.

  • Drug discovery: Naphthoquinones and their analogs have been investigated as potential antimicrobial and antitumor agents . Understanding the interaction of these compounds with NQOs may aid in the development of new drugs.

  • Enzyme engineering: Modifying the substrate specificity and catalytic activity of NQOs for specific biotechnological applications.

Related Research

  • Azoreductases: Some azoreductases, primarily found in bacteria, have been shown to possess NAD(P)H quinone oxidoreductase activity, suggesting a common evolutionary origin and functional overlap between these enzyme families .

  • Proteasome Inhibitors: Naphthoquinone analogs have been identified as proteasome inhibitors, demonstrating their potential as anticancer agents. These compounds interact with specific subunits of the proteasome, disrupting its function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Acorus americanus (Sweetflag) (Acorus calamus var. americanus)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLLISSVIPILAFLISGVLAPTREGPEKLSSYESGIEPIGDAWVQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFLEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) transfers electrons from NAD(P)H to plastoquinones via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially in a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and what is its primary function in plant chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical subunit of the chloroplastic NAD(P)H dehydrogenase (NDH) complex that shuttles electrons from NAD(P)H to plastoquinone in the photosynthetic electron transport chain. The NDH complex couples electron transfer reactions to proton translocation, thereby conserving redox energy in the form of a proton gradient . In Acorus americanus, this protein plays a crucial role in both photosynthetic and potentially respiratory electron transport chains within chloroplasts.

The enzyme catalyzes the two-electron transfer from NAD(P)H to quinones via flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers. This process is particularly important under various stress conditions when the primary photosynthetic electron transport chain is compromised. Unlike related proteins in human systems that may function in xenobiotic metabolism, the chloroplastic ndhC is primarily involved in energy transduction processes within the plant cell.

How does Acorus americanus ndhC differ structurally and functionally from Acorus calamus ndhC?

While both Acorus americanus and Acorus calamus contain ndhC proteins with similar functions, there are subtle differences between them that reflect their evolutionary divergence. These distinctions are important for researchers studying the comparative biochemistry of these closely related species.

Acorus americanus (American Sweet Flag) and Acorus calamus (Sweet Flag) are often confused taxonomically. A. americanus is native to North America, while A. calamus was introduced from Europe and Asia . The key distinctions in their ndhC proteins include:

FeatureA. americanus ndhCA. calamus ndhC
Reproductive capabilityProduces viable seeds and fruitsPrimarily sterile (triploid), rarely produces seeds
Genetic diversityHigher genetic diversity in native populationsLower genetic diversity due to clonal propagation
Expression patternsMay show higher expression under certain stress conditionsExpression profiles differ under similar conditions
Protein interactionsPotentially different interaction partners in chloroplast complexesMay form slightly different protein-protein interactions

These differences are significant for researchers studying the evolution of NDH complexes across species and may explain some of the physiological differences observed between these plants .

What methods are used to confirm the purity and identity of recombinant ndhC protein from Acorus americanus?

Confirming the purity and identity of recombinant Acorus americanus ndhC requires a systematic approach using multiple analytical techniques:

  • SDS-PAGE analysis: Purified protein should show a single band at the expected molecular weight. For recombinant ndhC with affinity tags, the observed molecular weight should match the predicted size.

  • Western blot analysis: Using antibodies specific to ndhC or to affinity tags if present (such as a His-tag). Comparative analysis with native protein extracts can confirm identity.

  • Mass spectrometry analysis:

    • MALDI-TOF MS or LC-MS/MS following tryptic digestion to confirm protein sequence

    • Intact mass analysis to verify full-length protein and post-translational modifications

  • Spectroscopic analysis:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Fluorescence spectroscopy to assess cofactor binding (FAD/FMN)

  • Activity assays: Enzymatic activity measurements using quinone substrates and NAD(P)H, comparing kinetic parameters with predicted values for this enzyme class .

For recombinant proteins produced in systems like E. coli, baculovirus, or yeast expression systems, verification of >90% purity is typically expected, with proper folding confirmed by activity assays .

What expression systems are most effective for producing functional recombinant Acorus americanus ndhC protein?

Several expression systems have been evaluated for the production of functional chloroplastic proteins like ndhC, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsYieldRecommended for
E. coliRapid growth, high yield, simple genetic manipulationLack of post-translational modifications, inclusion body formationUp to 50 mg/LInitial structural studies, antibody production
Yeast (P. pastoris)Post-translational modifications, proper folding of complex proteinsLonger expression time, more complex media10-30 mg/LFunctional studies requiring proper folding
Baculovirus/insect cellsMore native-like post-translational modificationsHigher cost, longer production time5-20 mg/LStudies of protein-protein interactions
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield1-5 mg/LSpecialized applications requiring mammalian modifications
  • Codon optimization: Adapting the gene sequence to the expression host's codon usage

  • N-terminal modifications: Removal of chloroplast transit peptides that may interfere with bacterial expression

  • Solubility enhancement: Fusion with solubility-enhancing tags (MBP, SUMO, etc.)

  • Co-expression with chaperones: To facilitate proper folding

  • Expression conditions: Lower temperatures (16-20°C) often improve folding of plant proteins in bacterial systems

Recommended protocol: Transform codon-optimized ndhC (without transit peptide) into E. coli BL21(DE3) cells, induce with 0.1-0.5 mM IPTG at OD600 of 0.6-0.8, and express at 18°C for 16-20 hours to maximize soluble protein yield .

How can researchers effectively measure the enzymatic activity of recombinant ndhC in vitro?

Measuring the enzymatic activity of recombinant ndhC requires careful consideration of its electron transfer function. The following methodological approaches are recommended:

Basic Spectrophotometric Assay:

  • Prepare reaction buffer (typically 50 mM Tris-HCl, pH 7.5, containing 1 mM MgCl₂)

  • Add purified ndhC protein (1-5 µg/ml)

  • Add NAD(P)H (50-200 µM)

  • Initiate reaction by adding quinone substrate (50-200 µM)

  • Monitor decrease in absorbance at 340 nm (NAD(P)H oxidation)

Advanced Kinetic Analysis:
For detailed kinetic characterization, researchers should perform:

  • Determination of optimal pH and temperature (typically pH 6.5-8.0, 25-37°C)

  • Michaelis-Menten kinetics with varying substrate concentrations

  • Inhibitor studies using specific NDH complex inhibitors

  • Cofactor requirements (FAD/FMN binding assessment)

Data Analysis Parameters:
The kinetic parameters should be calculated using non-linear regression:

  • Km for NAD(P)H (typically 10-100 µM)

  • Km for quinone substrates (typically 5-50 µM)

  • kcat (catalytic rate constant)

  • Specificity constants (kcat/Km)

When comparing ndhC activity across species or conditions, researchers should normalize activity to protein concentration and ensure consistent assay conditions . Electrochemical detection methods can also be employed for more sensitive measurements of quinone reduction.

What are the optimal storage conditions for maintaining stability and activity of recombinant Acorus americanus ndhC?

The stability of recombinant ndhC protein is crucial for reliable experimental results. Based on data from similar proteins, the following storage protocol is recommended:

Short-term Storage (1-2 weeks):

  • Store at 4°C in storage buffer containing:

    • 50 mM phosphate buffer or Tris-HCl, pH 7.5

    • 150 mM NaCl

    • 10% glycerol

    • 1 mM DTT or 5 mM β-mercaptoethanol

    • Optional: 0.02% sodium azide to prevent microbial growth

Long-term Storage:

  • Store at -20°C or preferably -80°C

  • Add glycerol to final concentration of 25-50%

  • Aliquot in small volumes (50-100 μl) to avoid freeze-thaw cycles

  • Flash-freeze in liquid nitrogen before transferring to freezer

Stability Assessment:
Periodic activity measurements should be conducted to verify protein stability. A typical stability profile for properly stored ndhC shows:

  • 4°C: ~80% activity retention after 1 week

  • -20°C: ~70% activity retention after 3 months

  • -80°C: >90% activity retention after 1 year

Important Considerations:

  • Avoid repeated freeze-thaw cycles (limit to ≤3)

  • Working aliquots can be kept at 4°C for up to one week

  • Addition of FAD (5-10 μM) to storage buffer may help maintain enzymatic activity

  • For highest stability, lyophilization with appropriate cryoprotectants can be considered

What are the approaches for investigating ndhC interactions with other components of photosynthetic and respiratory electron transport chains?

Investigating protein-protein interactions involving ndhC requires specialized techniques that can capture both stable and transient interactions within membrane protein complexes:

In Vitro Approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against ndhC or epitope tags in recombinant proteins

    • Analyze co-precipitated proteins by mass spectrometry

    • Quantitative Co-IP can determine binding affinities and stoichiometry

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to stabilize interactions

    • Digest crosslinked complexes and identify crosslinked peptides by MS

    • Provides spatial constraints for modeling protein complexes

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified ndhC on a sensor chip

    • Flow potential interaction partners over the surface

    • Measure association/dissociation kinetics in real-time

In Vivo Approaches:

  • Split-GFP or BiFC Systems:

    • Fuse ndhC and potential partners to complementary fragments of fluorescent proteins

    • Reconstitution of fluorescence indicates proximity in living cells

    • Especially useful for chloroplast-localized interactions

  • FRET/FLIM Analysis:

    • Label ndhC and interaction partners with FRET-compatible fluorophores

    • Measure energy transfer efficiency to determine proximity

    • Can be performed in isolated chloroplasts or intact plant cells

  • Proximity-Dependent Labeling:

    • Fusion of ndhC with enzymes like BioID or APEX2

    • Biotinylation of proximal proteins in native environment

    • MS identification of biotinylated partners

Data Integration and Validation:

Data from multiple approaches should be integrated to build interaction networks. For example, combining XL-MS spatial constraints with cryo-EM density maps can reveal how ndhC positions within the larger NDH complex and how it interacts with components of both photosynthetic and respiratory electron transport chains .

Validation of interactions should include:

  • Mutational analysis of predicted interface residues

  • Competition assays with peptides derived from interface regions

  • Functional assays to determine the physiological relevance of identified interactions

How can comparative genomic and proteomic approaches enhance our understanding of ndhC evolution across plant species?

Comparative genomic and proteomic approaches provide powerful tools to understand the evolution and functional diversification of ndhC across plant species:

Genomic Approaches:

  • Phylogenetic Analysis:

    • Multiple sequence alignment of ndhC genes from diverse plant species

    • Construction of phylogenetic trees to infer evolutionary relationships

    • Identification of conserved regions indicating functional constraints

    • Analysis of selection pressures using dN/dS ratios

  • Synteny Analysis:

    • Comparison of gene organization around ndhC locus across species

    • Identification of conserved gene clusters suggesting functional relationships

    • Detection of genomic rearrangements affecting ndhC expression or regulation

  • Comparative Promoter Analysis:

    • Identification of conserved regulatory elements in ndhC promoters

    • Prediction of transcription factor binding sites

    • Correlation with expression patterns across species

Proteomic Approaches:

  • Structural Proteomics:

    • Homology modeling of ndhC across species

    • Comparison of predicted structural features

    • Identification of structurally conserved domains versus variable regions

  • Functional Proteomics:

    • Comparative analysis of post-translational modifications

    • Interactome mapping across species

    • Identification of species-specific interaction partners

Evolutionary Insights:
Comparative analysis between Acorus species (representing early-diverging monocots) and other plant lineages has revealed fascinating evolutionary patterns in ndhC:

Plant GroupndhC FeaturesEvolutionary Implications
Early land plants (moss, liverworts)Basic NDH complexAncestral function in cyclic electron flow
GymnospermsVariable presence/absencePossible functional redundancy
Monocots (including Acorus)Highly conserved sequenceEssential function maintained
EudicotsMore sequence divergencePotential functional specialization
Parasitic plantsOften lost or pseudogenizedReduced photosynthetic requirement

Analysis between A. americanus and A. calamus ndhC shows subtle differences that may reflect adaptation to different ecological niches . These comparative approaches have revealed that while the core function of ndhC in electron transport is conserved, there are species-specific adaptations that may correlate with environmental conditions, photosynthetic efficiency, and stress responses.

What role does ndhC play in plant responses to environmental stressors, and how can researchers study these functions?

The ndhC subunit and the NDH complex have been implicated in plant responses to various environmental stressors. Studying these functions requires integrated approaches:

Key Stress Response Functions:

  • Drought Stress Response:

    • NDH-mediated cyclic electron flow increases under water deficit

    • Helps maintain ATP/NADPH ratio during stomatal closure

    • Contributes to photoprotection during drought-induced metabolic limitations

  • Temperature Stress Adaptation:

    • Enhanced NDH activity observed during cold stress

    • May contribute to thermal dissipation of excess energy under heat stress

    • Helps maintain photosynthetic efficiency at temperature extremes

  • Light Stress Protection:

    • NDH complex activity increases under high light conditions

    • Participates in alternative electron transport pathways

    • Reduces photoinhibition by dissipating excess excitation energy

Methodological Approaches:

  • Transgenic Approaches:

    • RNAi-mediated knockdown of ndhC expression

    • CRISPR/Cas9-based knockout or specific mutations

    • Overexpression studies to assess gain-of-function effects

  • Physiological Measurements:

    • Chlorophyll fluorescence analysis (Fv/Fm, NPQ, Phi2)

    • P700 redox state measurements (cyclic vs linear electron flow)

    • Electrochromic shift measurements (proton motive force)

    • Gas exchange measurements under stress conditions

  • Biochemical Analyses:

    • NDH complex activity assays in isolated thylakoids

    • ROS production measurement

    • Thylakoid membrane protein phosphorylation status

    • Metabolomics to assess stress-related metabolite changes

  • Transcript and Protein Analysis:

    • qRT-PCR for stress-responsive expression patterns

    • Proteomics to detect stress-induced changes in NDH complex composition

    • Analysis of post-translational modifications under stress conditions

Research Design Example:
To study ndhC's role in drought stress adaptation, researchers could employ a comprehensive approach:

  • Compare wild-type and ndhC-deficient plants under progressive drought

  • Monitor photosynthetic parameters (gas exchange, chlorophyll fluorescence)

  • Assess NDH complex assembly and activity in isolated thylakoids

  • Quantify stress-related metabolites and signaling molecules

  • Measure plant growth, development, and recovery after drought

Studies in Acorus americanus would be particularly valuable as this species inhabits wetland environments that may experience periodic drying, potentially revealing specialized adaptations of ndhC to these conditions .

How does the ndhC structure and function in Acorus americanus compare to other monocot species, and what experimental approaches reveal these differences?

Comparative analysis of ndhC across monocot species reveals important evolutionary adaptations that may reflect ecological specialization. Several experimental approaches can elucidate these differences:

Structural Comparisons:

The ndhC protein from Acorus americanus (representing early-diverging monocots) shows both conservation and divergence when compared with other monocots:

FeatureA. americanus ndhCGrass Family ndhCPalm Family ndhC
Sequence identityBaseline75-85%80-90%
Transmembrane domains3-43-4 (conserved)3-4 (conserved)
Quinone-binding residuesHighly conservedHighly conservedHighly conserved
N-terminal regionMore variableMore conservedIntermediate
Post-translational modification sitesFewerMore abundantVariable

Functional Differences:

  • Enzymatic Properties:

    • Substrate specificity may differ between species

    • Kinetic parameters (Km, Vmax) show species-specific optimization

    • Temperature and pH optima reflect environmental adaptations

  • Complex Assembly:

    • Differences in NDH subunit composition between monocot lineages

    • Unique auxiliary proteins in different species

    • Varied regulation of complex assembly and turnover

Experimental Approaches to Reveal Differences:

  • Recombinant Protein Studies:

    • Express ndhC from multiple species in the same system

    • Compare biochemical properties under identical conditions

    • Perform enzyme kinetics with various substrates and cofactors

  • Chimeric Protein Analysis:

    • Create fusion proteins with domains from different species

    • Identify regions responsible for species-specific functions

    • Test chimeras in both in vitro and in vivo systems

  • Crystallography and Structural Biology:

    • Solve structures of ndhC from different monocots

    • Identify structural differences that correlate with function

    • Use molecular dynamics simulations to predict functional consequences

  • Complementation Studies:

    • Express A. americanus ndhC in mutants of other species lacking functional ndhC

    • Assess degree of functional complementation

    • Identify species-specific requirements for proper function

  • Environmental Response Studies:

    • Compare ndhC expression and NDH activity across species under identical stress conditions

    • Correlate differences with ecological niches

    • Identify adaptive changes that enhance fitness in specific environments

Acorus americanus, being among the earliest diverging monocot lineages, provides a valuable reference point for understanding the evolution of ndhC function across monocots. Its adaptation to wetland environments may have selected for specific features of ndhC that optimize photosynthetic efficiency under fluctuating light and water conditions .

What is known about the relationship between ndhC function and plant photosynthetic efficiency, and how can this be experimentally measured?

The ndhC subunit, as part of the NDH complex, plays significant roles in optimizing photosynthetic efficiency through several mechanisms. Understanding and measuring these contributions requires sophisticated experimental approaches:

Functional Contributions to Photosynthetic Efficiency:

  • Cyclic Electron Flow (CEF):

    • NDH complex mediates one pathway of CEF around Photosystem I

    • Generates additional ATP without NADPH production

    • Helps balance ATP:NADPH ratio for Calvin-Benson cycle

    • Particularly important under stress conditions

  • Photoprotection:

    • NDH-mediated CEF contributes to non-photochemical quenching (NPQ)

    • Helps dissipate excess excitation energy as heat

    • Reduces photoinhibition under high light conditions

  • Chlororespiration:

    • NDH may participate in chlororespiratory electron transport

    • Enables plastoquinone reduction in darkness

    • Maintains electron transport chain redox balance

  • CO₂ Concentration Mechanisms:

    • In some species, NDH contributes to inorganic carbon accumulation

    • May enhance photosynthetic carbon fixation efficiency

Experimental Measurement Approaches:

  • Gas Exchange Coupled with Chlorophyll Fluorescence:

    • Simultaneous measurement of CO₂ assimilation and PSII efficiency

    • Calculation of electron transport rate (ETR)

    • Assessment of photorespiration through combined gas exchange parameters

    • Construction of light and CO₂ response curves

  • P700 Absorbance Measurements:

    • Quantification of PSI oxidation state

    • Calculation of cyclic vs. linear electron flow

    • Assessment of NDH contribution to PSI electron donation

  • Electrochromic Shift (ECS) Spectroscopy:

    • Measurement of thylakoid membrane potential

    • Quantification of proton motive force (pmf)

    • Determination of NDH contribution to pmf formation

  • Thylakoid Membrane Preparation Assays:

    • Isolation of thylakoid membranes

    • Measurement of NADH-dependent plastoquinone reduction

    • Inhibitor studies to distinguish NDH-dependent pathways

    • Assessment of NDH complex activity and abundance

Experimental Design for Acorus americanus:

To investigate ndhC's contribution to photosynthetic efficiency in Acorus americanus:

  • Comparative Physiological Analysis:

    • Compare wild-type plants with plants having reduced ndhC expression

    • Measure photosynthetic parameters under varying light, CO₂, and stress conditions

    • Quantify growth and biomass accumulation as integrative measures of efficiency

  • Environmental Response Assessment:

    • Monitor NDH activity across diurnal cycles

    • Compare activity under different water availability conditions

    • Assess responses to fluctuating light (mimicking natural conditions)

  • Molecular and Biochemical Correlation:

    • Quantify ndhC transcript and protein levels

    • Measure NDH complex assembly and stability

    • Correlate with photosynthetic efficiency parameters

The unique wetland habitat of Acorus americanus suggests that its ndhC may have evolved specific adaptations for optimizing photosynthesis under conditions of high humidity, potentially fluctuating light, and occasional water stress . These adaptations may provide valuable insights for engineering improved photosynthetic efficiency in crop plants.

What are the main technical challenges in studying recombinant Acorus americanus ndhC, and how can researchers overcome them?

Researchers face several significant technical challenges when working with recombinant ndhC from Acorus americanus:

Challenge 1: Protein Expression and Solubility

  • Issue: As a membrane-associated protein, ndhC tends to form inclusion bodies or aggregate during heterologous expression.

  • Solutions:

    • Use specialized expression vectors with solubility-enhancing tags (MBP, SUMO, Trx)

    • Optimize expression conditions (temperature reduction to 16-18°C, low IPTG concentration)

    • Consider cell-free expression systems that can incorporate lipids or detergents

    • Express truncated versions lacking highly hydrophobic regions for structural studies

Challenge 2: Protein Purification and Stability

  • Issue: Maintaining stability and activity during purification process.

  • Solutions:

    • Include appropriate detergents (DDM, LMNG, or CHAPS) throughout purification

    • Add lipids to mimic native environment (POPC, POPE)

    • Incorporate stabilizing additives (glycerol, specific ions, reducing agents)

    • Use gentle purification methods (avoid harsh elution conditions)

    • Implement quality control at each purification step (activity assays, thermal stability tests)

Challenge 3: Reconstitution of Enzyme Activity

  • Issue: Achieving native-like activity with the recombinant protein.

  • Solutions:

    • Ensure proper cofactor incorporation (FAD/FMN)

    • Reconstitute with other NDH complex components

    • Test different lipid compositions for optimal activity

    • Optimize buffer conditions (pH, ionic strength, specific ions)

Challenge 4: Structural Characterization

  • Issue: Obtaining structural information for a membrane protein.

  • Solutions:

    • Use cryo-EM for larger complexes

    • Consider lipidic cubic phase crystallization

    • Employ NMR for specific domains or fragments

    • Use computational approaches (AlphaFold2) combined with experimental validation

Technical Workflow Recommendation:

StageRecommended ApproachAlternative Methods
Gene preparationCodon optimization for expression hostGene synthesis with removal of problematic sequences
Expression systemE. coli with cold shock promoterInsect cells for complex formation
Induction0.1 mM IPTG, 18°C, 16-20 hoursAuto-induction media
Lysis/ExtractionDetergent screening (DDM, LMNG, etc.)Membrane fractionation followed by detergent solubilization
PurificationIMAC followed by size exclusionAffinity purification with specific antibodies
Activity reconstitutionLiposome reconstitutionNanodiscs for single-molecule studies
Structural analysisHomology modeling with AlphaFold2 validationHydrogen-deuterium exchange mass spectrometry

By implementing these methodological solutions, researchers can overcome the inherent challenges of working with this complex membrane protein and achieve more reliable experimental outcomes .

What emerging technologies and methodologies are advancing our understanding of chloroplastic NAD(P)H-quinone oxidoreductases?

The field of chloroplastic NAD(P)H-quinone oxidoreductase research is rapidly evolving with several cutting-edge technologies enabling new discoveries:

Advanced Structural Biology Techniques

  • Cryo-Electron Microscopy (Cryo-EM): Providing unprecedented resolution of membrane protein complexes without crystallization

  • Integrative Structural Biology: Combining multiple techniques (X-ray crystallography, NMR, SAXS, mass spectrometry) to build comprehensive structural models

  • Time-Resolved Structural Methods: Capturing different conformational states during the catalytic cycle

  • AI-Based Structure Prediction: Tools like AlphaFold2 and RoseTTAFold revolutionizing protein structure prediction

Single-Molecule Approaches

  • Single-Molecule FRET: Detecting conformational changes in real-time

  • Single-Particle Tracking: Following NDH complex assembly and movement in thylakoid membranes

  • Optical Tweezers: Measuring force generation and protein-protein interactions

  • Nanodiscs and Liposome Technology: Reconstituting functional proteins in defined membrane environments

Advanced Spectroscopy

  • Ultrafast Transient Absorption Spectroscopy: Tracking electron transfer events at femtosecond to nanosecond timescales

  • 2D Electronic Spectroscopy: Revealing energy transfer pathways and coupling between cofactors

  • Advanced EPR Techniques: Characterizing paramagnetic centers and their environments

  • Resonance Raman Spectroscopy: Providing vibrational information about specific chromophores

Genome Editing and Synthetic Biology

  • CRISPR/Cas9 Precision Editing: Creating specific mutations in ndhC to study structure-function relationships

  • Plastid Transformation: Directly modifying chloroplast genomes to study ndhC variants

  • Minimal NDH Complex Design: Synthetic biology approaches to create simplified functional units

  • Optogenetic Control: Light-responsive modules to regulate NDH complex activity

Systems Biology Integration

  • Multi-Omics Integration: Combining transcriptomics, proteomics, and metabolomics data

  • Computational Modeling: In silico prediction of electron flow under various conditions

  • Network Biology: Mapping the interactome of ndhC within chloroplasts

  • Machine Learning Applications: Pattern recognition in large-scale phenotypic data

Future Research Directions:
These emerging technologies are enabling several promising research directions:

  • Dynamic Assembly Studies: Understanding the spatiotemporal dynamics of NDH complex assembly and disassembly in response to environmental cues

  • Electron Transfer Mechanisms: Resolving the precise electron transfer pathways and coupling mechanisms within the NDH complex

  • Evolutionary Design Principles: Comparative analyses across species to understand how natural selection has optimized NDH function in different ecological niches

  • Biotechnological Applications: Engineering optimized NDH complexes for enhanced photosynthetic efficiency or bioenergy applications

  • Environmental Adaptation: Understanding how NDH complex composition and activity adjust to changing environmental conditions, particularly relevant for plants like Acorus americanus that must adapt to varying water availability .

What future research directions might yield the most significant insights into the role of ndhC in plant adaptation and evolution?

Future research on ndhC offers promising avenues for understanding plant adaptation and evolution, particularly in the context of changing environments and evolutionary history:

Evolutionary Genomics and Adaptation

  • Comprehensive Phylogenomic Analysis: Sequence ndhC from diverse plant lineages, including rare and ancient groups

  • Selection Analysis: Identify sites under positive selection that may indicate adaptive evolution

  • Resurrection Ecology: Compare ndhC sequences from herbarium specimens or fossilized materials with modern relatives

  • Ancestral Sequence Reconstruction: Express reconstructed ancestral ndhC to study functional evolution

Climate Change Response Studies

  • Long-term Experimental Evolution: Subject plants to simulated future climate conditions and track ndhC adaptations

  • Comparative Stress Physiology: Analyze ndhC response across species with different ecological niches

  • Ecotypic Variation: Compare ndhC structure and function across Acorus americanus populations from diverse habitats

  • Predictive Modeling: Use machine learning to predict ndhC adaptations under various climate scenarios

Molecular Mechanism Elucidation

  • Complete NDH Complex Structure: Determine high-resolution structures of the entire complex with ndhC in context

  • Quantum Mechanical Studies: Apply quantum calculations to understand electron transfer mechanisms

  • Post-translational Modification Mapping: Comprehensive analysis of regulatory modifications

  • Protein Dynamics: Study conformational changes during catalysis using advanced spectroscopy

Synthetic Biology and Biotechnology

  • Designer NDH Complexes: Engineer optimized versions for improved photosynthetic efficiency

  • Cross-species Complementation: Systematic analysis of functional conservation and divergence

  • De Novo Design: Create minimal synthetic ndhC proteins to understand essential functional elements

  • Biosensor Development: Use ndhC-based constructs to monitor cellular redox states

Research Priority Matrix:

Research DirectionPotential ImpactTechnical FeasibilityTimelineKey Technologies Required
NDH complex structure-functionVery HighModerate3-5 yearsCryo-EM, directed evolution, synthetic biology
Evolutionary adaptationHighHigh2-4 yearsGenomics, bioinformatics, ancestral reconstruction
Stress response mechanismsHighHigh1-3 yearsCRISPR, advanced imaging, metabolomics
Photosynthetic optimizationVery HighModerate-Low5-10 yearsSynthetic biology, chloroplast transformation
Systems biology integrationHighModerate3-5 yearsMulti-omics, AI/ML, network modeling

Specific High-Priority Questions:

  • How does ndhC contribute to cyclic electron flow optimization under fluctuating light conditions typical of Acorus americanus wetland habitats?

  • What structural adaptations in ndhC have evolved in response to transitions between aquatic and terrestrial environments?

  • How do post-translational modifications of ndhC regulate NDH complex activity in response to environmental stressors?

  • Can engineered modifications to ndhC enhance photosynthetic efficiency and stress tolerance in crop species?

  • What is the role of ndhC in the evolutionary divergence between Acorus americanus and Acorus calamus, particularly regarding their different reproductive strategies?

These research directions will not only advance our fundamental understanding of plant photosynthesis and evolution but may also contribute to developing climate-resilient crops and novel biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.