UniProt ID: A9LYF3
Gene Name: ndhG
Protein Family: NAD(P)H-quinone oxidoreductase (NQO) family
| Property | Description |
|---|---|
| Length | 177 amino acids |
| Expression System | E. coli with N-terminal His tag |
| Molecular Function | Catalyzes electron transfer from NAD(P)H to quinones |
| Subcellular Localization | Chloroplastic |
The enzyme operates via a substituted enzyme (ping-pong) mechanism, utilizing a tightly bound FAD cofactor for redox reactions . Key structural features include:
Active Sites: Formed at the interface of homodimeric subunits .
Inhibitors: Dicoumarol (competitive inhibitor with K<sub>i</sub> ≈ 50 pM in homologous systems) .
Thermal Stability: Melting temperature (T<sub>m</sub>) data for recombinant forms is pending, but homologous NQO1 enzymes show T<sub>m</sub> ~45–55°C .
Amino Acid Sequence (Partial):
MDLPGPIHDVLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSYFVAA...
Photosynthesis Studies: Investigates chloroplastic electron transport in Acorus americanus .
Drug Development: Serves as a model for designing inhibitors targeting NAD(P)H:quinone oxidoreductases in cancer cells .
Enzyme Engineering: Used to study FAD cofactor binding dynamics and protein stability .
NAD(P)H-quinone oxidoreductase is an antioxidant flavoprotein that catalyzes the reduction of reactive quinone metabolites using NAD(P)H as an electron donor. In chloroplasts, this enzyme complex (also known as NDH complex) plays crucial roles in cyclic electron flow around photosystem I, chlororespiration, and photoprotection. The enzyme facilitates electron transfer from NAD(P)H to plastoquinone, thereby contributing to the proton gradient across the thylakoid membrane and ATP synthesis. In Acorus species, the chloroplastic NAD(P)H-quinone oxidoreductase complex represents an ancestral form that can provide insights into the evolution of photosynthetic machinery in monocots .
Acorus represents the sister lineage to all other extant monocot plants, making it a crucial taxon for understanding early monocot evolution. Phylogenetic analyses based on both chloroplast and nuclear genes consistently support Acorus as the sister group to the remaining monocots, although mitochondrial genome data has sometimes placed it differently. This phylogenetic position makes proteins from Acorus, including NAD(P)H-quinone oxidoreductase, particularly valuable for understanding ancestral states of monocot cellular machinery. The genome of Acorus species contains approximately 45% fewer genes than the majority of monocots, despite having similar genome sizes, suggesting significant differences in genome organization and evolution .
The NAD(P)H-quinone oxidoreductase complex in Acorus chloroplasts consists of multiple subunits, including the subunit 6 that is the focus of recombinant protein studies. The chloroplastic NDH complex in Acorus contains both nuclear-encoded and chloroplast-encoded subunits that assemble into a functional enzyme. The subunit 6 plays a role in the electron transfer pathway and is encoded by the chloroplast genome. The structure of this complex is of particular interest because it represents an ancestral form that predates the tau (τ) whole-genome duplication event that occurred in most other monocot lineages .
| Subunit | Encoding Genome | Approximate Size (kDa) | Primary Function |
|---|---|---|---|
| Subunit 4L (ndhE) | Chloroplast | 10-12 | Membrane anchoring |
| Subunit 6 | Chloroplast | 15-18 | Electron transport |
| NdhA-G | Chloroplast | Various | Core complex components |
| Nuclear subunits | Nuclear | Various | Regulatory and assembly functions |
Studies of NAD(P)H-quinone oxidoreductase in Acorus species have demonstrated its role in both antioxidant defense and electron transport. The enzyme catalyzes the reduction of quinones to hydroquinones, preventing the formation of highly reactive semiquinone intermediates that can generate reactive oxygen species. Experimental evidence indicates that the enzyme is particularly active under stress conditions, including high light intensity and temperature fluctuations. Functional analysis through recombinant protein expression has revealed that the Acorus NAD(P)H-quinone oxidoreductase exhibits catalytic properties similar to those of other plant species but with distinct kinetic parameters, suggesting evolutionary adaptations specific to the wetland environments where Acorus species typically grow .
Research has revealed that Acorus exhibits significantly higher mutation rates in mitochondrial genes compared to most other angiosperms, which has led to phylogenetic inconsistencies when using mitochondrial genome data. For NAD(P)H-quinone oxidoreductase research, this presents challenges in comparative genomics approaches. Analyses of branch lengths in phylogenetic trees show that Acorus has a longer divergence (d) branch length compared to other sampled angiosperms for most mitochondrial genes. This elevated mutation rate appears to have occurred before intrageneric diversification, suggesting ancient genomic events that affected the entire Acorus lineage .
When studying chloroplastic genes like those encoding NAD(P)H-quinone oxidoreductase subunits, researchers must account for these differential mutation rates across organellar genomes. For accurate evolutionary interpretations, it is recommended to use multiple genomic sources (nuclear, chloroplast, and mitochondrial) while applying appropriate models of sequence evolution that can accommodate heterogeneous mutation rates. This is particularly important when investigating the divergence times and selective pressures acting on functional genes like those encoding NAD(P)H-quinone oxidoreductase subunits.
Based on research experience with similar chloroplastic proteins, the following expression and purification strategy is recommended:
| Purification Step | Conditions | Purpose |
|---|---|---|
| Immobilized metal affinity chromatography | 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% DDM, 10-250 mM imidazole gradient | Initial capture and enrichment |
| Size exclusion chromatography | 20 mM HEPES pH 7.5, 150 mM NaCl, 0.05% DDM | Separation of monomeric/oligomeric forms |
| Ion exchange chromatography | 20 mM Tris-HCl pH 8.0, 50-500 mM NaCl gradient, 0.05% DDM | Further purification and removal of contaminants |
Activity Verification: NADH/NADPH oxidation assays using 2,6-dichlorophenolindophenol (DCPIP) or ubiquinone as electron acceptors can confirm the functionality of the purified recombinant enzyme .
While both plant and mammalian NAD(P)H-quinone oxidoreductases catalyze similar reactions, they exhibit significant differences in structure, regulation, and physiological roles. In mammals, there are two major NQO enzymes—NQO1 and NQO2—that function primarily in detoxification processes and protection against oxidative stress. These enzymes have been extensively studied for their roles in disease prevention and cancer .
Comparative analysis reveals:
Structural Differences: Mammalian NQO1 functions as a homodimer, while the chloroplastic NAD(P)H-quinone oxidoreductase in Acorus is a multi-subunit complex.
Biological Functions: Mammalian NQO1 exerts antioxidant activities, anti-inflammatory effects, and interactions with tumor suppressors, protecting against various diseases including cardiovascular damage and metabolic syndrome. In contrast, the chloroplastic enzyme in Acorus primarily functions in photosynthetic electron transport and photoprotection.
Subcellular Localization: Mammalian NQO1 is predominantly cytosolic with some association with mitochondria, while the Acorus enzyme is specifically localized to chloroplasts.
Regulatory Mechanisms: Mammalian NQO1 is regulated by the Nrf2 pathway and responds to oxidative stress, while the regulation of chloroplastic NAD(P)H-quinone oxidoreductase in Acorus is integrated with photosynthetic activity and light conditions.
This comparative understanding is valuable for researchers investigating the evolution of redox systems across different kingdoms and for potential applications in biotechnology and medicine .
The phylogenetic placement of Acorus presents an interesting methodological challenge due to discrepancies between different genomic compartments. While nuclear and chloroplast data consistently place Acorus as sister to all other monocots, mitochondrial genome data has sometimes placed it as a relative of core alismatids. This inconsistency affects the interpretation of all Acorus proteins, including NAD(P)H-quinone oxidoreductase .
To resolve these discrepancies, the following methodological approaches are recommended:
Multi-locus Analysis: Combining data from all three genomic compartments (nuclear, chloroplast, and mitochondrial) with appropriate partitioning and model selection can provide a more comprehensive phylogenetic framework.
Accounting for Rate Heterogeneity: Implementing models that account for variable rates of evolution across sites and lineages, such as mixed models or relaxed molecular clock methods, can help mitigate the effects of the elevated mutation rates observed in Acorus mitochondrial genes.
Gene Tree Reconciliation: Explicitly modeling the discordance between gene trees and species trees using methods such as coalescent-based approaches or gene tree parsimony can help identify instances of incomplete lineage sorting or horizontal gene transfer.
Targeted Sequencing of Protein-coding Genes: For studies focused on specific proteins like NAD(P)H-quinone oxidoreductase, sequencing homologous genes from multiple Acorus species and closely related taxa can provide higher resolution for understanding the evolution of these functional elements.
The analysis of d and Sd values for mitochondrial genes has shown that Acorus has longer branch lengths compared to other angiosperms, indicating elevated mutation rates that could explain the phylogenetic inconsistencies .
When designing primers for the amplification of chloroplastic NAD(P)H-quinone oxidoreductase genes from Acorus, researchers should consider:
| Parameter | Recommended Range | Rationale |
|---|---|---|
| Length | 18-25 nucleotides | Balances specificity with annealing efficiency |
| GC content | 40-60% | Ensures stable annealing |
| Melting temperature (Tm) | 55-65°C | Optimizes PCR conditions |
| 3' end stability | Last 5 bases with 2-3 G/C | Improves extension efficiency |
| Secondary structures | Minimize hairpins and dimers | Improves amplification efficiency |
Target Region Selection: For functional studies, primers should be designed to amplify the complete coding sequence including any transit peptide regions. For diversity studies, both coding and non-coding regions may be targeted to capture different aspects of evolutionary history.
Species-specific Optimization: PCR conditions should be optimized specifically for Acorus samples, often requiring higher annealing temperatures (58-62°C) and longer extension times than those used for other monocot species.
Accurate assessment of recombinant NAD(P)H-quinone oxidoreductase activity is essential for functional studies. The following methodological approach is recommended:
Spectrophotometric Assays:
The primary method involves monitoring the decrease in NAD(P)H absorption at 340 nm.
Standard reaction mixture: 50 mM phosphate buffer (pH 7.4), 200 μM NAD(P)H, 40 μM ubiquinone or other quinone substrate, and purified enzyme.
Activity is calculated using the extinction coefficient of NAD(P)H (6,220 M⁻¹cm⁻¹).
Alternative Electron Acceptors:
2,6-dichlorophenolindophenol (DCPIP) can be used as an alternative electron acceptor, monitored at 600 nm.
Cytochrome c reduction (monitored at 550 nm) can provide another measure of electron transfer activity.
Kinetic Analysis:
Determination of Km and Vmax values for both NAD(P)H and quinone substrates under varying conditions.
Assessment of inhibitor effects using compounds such as dicoumarol or flavonoids to characterize the enzyme's active site.
Redox Cycling Measurement:
Oxygen consumption rates using an oxygen electrode can quantify redox cycling activity.
Production of superoxide can be measured using nitroblue tetrazolium reduction assays.
Data Analysis:
Initial velocity measurements should be used for kinetic parameters.
Multiple replicates (minimum n=3) are necessary for statistical validity.
Control reactions without enzyme or without substrate are essential to account for background rates.
This comprehensive approach ensures accurate characterization of the enzymatic properties of recombinant NAD(P)H-quinone oxidoreductase from Acorus americanus .
Understanding protein-protein interactions is crucial for elucidating the functional role of NAD(P)H-quinone oxidoreductase in chloroplast physiology. Several complementary approaches can be employed:
Co-immunoprecipitation (Co-IP):
Generation of antibodies specific to Acorus NAD(P)H-quinone oxidoreductase subunit 6 or use of epitope tags in recombinant systems.
Solubilization of chloroplast membranes using mild detergents (digitonin or n-dodecyl-β-D-maltoside).
Identification of co-precipitated proteins by mass spectrometry.
Yeast Two-Hybrid (Y2H) Screening:
Construction of a bait plasmid containing the NAD(P)H-quinone oxidoreductase subunit 6 coding sequence.
Screening against a cDNA library derived from Acorus chloroplasts.
Verification of positive interactions through reciprocal tests and in vitro binding assays.
Bimolecular Fluorescence Complementation (BiFC):
Fusion of split fluorescent protein segments to NAD(P)H-quinone oxidoreductase and candidate interacting proteins.
Transient expression in plant protoplasts or chloroplast transformation systems.
Visualization of reconstituted fluorescence indicating protein-protein interaction.
Chemical Cross-linking coupled with Mass Spectrometry:
Treatment of isolated chloroplasts or thylakoid membranes with membrane-permeable cross-linking agents.
Isolation of NAD(P)H-quinone oxidoreductase complexes by immunoprecipitation or affinity purification.
Identification of cross-linked peptides by mass spectrometry to map interaction interfaces.
Cryo-electron Microscopy:
Purification of intact NAD(P)H-quinone oxidoreductase complexes from Acorus chloroplasts.
Structural determination by single-particle cryo-EM.
Comparison with structures from other plant species to identify Acorus-specific features.
These approaches provide complementary data on the interaction partners, binding interfaces, and functional associations of NAD(P)H-quinone oxidoreductase in the chloroplast environment .
The structural analysis of Acorus NAD(P)H-quinone oxidoreductase holds significant potential for informing evolutionary studies of monocots due to the basal position of Acorus in monocot phylogeny. Research approaches should include:
Comparative Structural Biology: Three-dimensional structures of Acorus NAD(P)H-quinone oxidoreductase subunits, determined through X-ray crystallography or cryo-electron microscopy, can be compared with homologs from other monocots to identify conserved functional domains and lineage-specific adaptations.
Ancestral Sequence Reconstruction: Using the Acorus sequence as an anchor point, ancestral sequence reconstruction can provide insights into the evolutionary trajectory of NAD(P)H-quinone oxidoreductase in monocots, particularly in relation to the tau (τ) whole-genome duplication event that occurred in most monocot lineages but not in Acorales .
Molecular Clock Analyses: The divergence of Acorus from other monocots provides a valuable calibration point for molecular clock studies. By analyzing the rate of sequence evolution in NAD(P)H-quinone oxidoreductase genes, researchers can better understand the timing of key evolutionary events in monocot history.
Functional Divergence Analysis: Comparing the enzymatic properties of recombinant NAD(P)H-quinone oxidoreductase from Acorus with those from derived monocot lineages can reveal how functional constraints and adaptive evolution have shaped this important enzyme complex throughout monocot diversification.
The genomic studies of Acorus have already revealed that it has approximately 45% fewer genes than most monocots despite similar genome sizes, suggesting significant genomic reorganization during monocot evolution. Structural analysis of key proteins like NAD(P)H-quinone oxidoreductase can provide a molecular-level understanding of these evolutionary processes .
NAD(P)H-quinone oxidoreductase plays crucial roles in stress adaptation in plants, including Acorus species. The relationship between enzyme function and stress adaptation involves:
Oxidative Stress Management: NAD(P)H-quinone oxidoreductase prevents the formation of reactive semiquinone intermediates, thereby reducing reactive oxygen species (ROS) generation under stress conditions. In Acorus, which typically inhabits wetland environments, this function is particularly important during fluctuating water levels and associated oxidative stress.
Energy Balance During Stress: The enzyme's role in cyclic electron flow contributes to maintaining ATP production under stress conditions when linear electron flow may be compromised. This is essential for energy-dependent stress responses such as ion homeostasis and osmotic adjustment.
Photoprotection: Under high light stress, NAD(P)H-quinone oxidoreductase contributes to photoprotection by providing an alternative electron sink, preventing over-reduction of the photosynthetic electron transport chain. This function is particularly relevant for Acorus species in their natural wetland habitats where they may experience varying light conditions.
Gene Expression Patterns: Transcriptomic studies have shown that genes involved in NAD(P)H-quinone oxidoreductase complex assembly and function are differentially regulated under various stress conditions, suggesting a coordinated response to environmental challenges.
The gene expansions and contractions identified in the Acorus genome related to stress resistance could provide additional context for understanding how NAD(P)H-quinone oxidoreductase function is integrated with broader stress adaptation mechanisms in these early-diverging monocots .
Recombinant Acorus NAD(P)H-quinone oxidoreductase offers a valuable tool for comparative studies of photosynthetic efficiency, particularly for understanding the evolution of photosynthetic machinery in monocots. Potential research applications include:
Reconstitution Experiments: Purified recombinant enzyme can be used in reconstitution experiments with isolated thylakoid membranes to assess its impact on electron transport rates and proton gradient formation. Comparing the effects of Acorus enzyme with those from other monocot species can reveal functional differences that may correlate with photosynthetic adaptations.
Site-Directed Mutagenesis Studies: Specific amino acid residues in the Acorus enzyme can be modified through site-directed mutagenesis to mimic sequences found in other monocots. The functional consequences of these changes can be assessed to determine how sequence evolution has affected enzyme activity and photosynthetic efficiency.
Heterologous Expression in Model Systems: The Acorus NAD(P)H-quinone oxidoreductase genes can be expressed in model plant systems with modified or deleted endogenous NDH complexes. This approach allows for in vivo assessment of how the ancestral-type enzyme from Acorus functions in the cellular environment of derived monocot species.
Biophysical Characterization: Techniques such as electron paramagnetic resonance (EPR) spectroscopy and transient absorption spectroscopy can be applied to recombinant Acorus enzyme to characterize its electron transfer properties and compare them with enzymes from other species.
These comparative approaches can provide insights into how evolutionary changes in NAD(P)H-quinone oxidoreductase have contributed to the diversification of photosynthetic mechanisms across monocot lineages, particularly in relation to the gene contractions and expansions associated with light harvesting observed in the Acorus genome .
Despite advances in our understanding of NAD(P)H-quinone oxidoreductase in Acorus, several significant questions remain unresolved:
Structural Uniqueness: How does the three-dimensional structure of Acorus NAD(P)H-quinone oxidoreductase compare with that of other monocots, and are there specific structural features that reflect its evolutionary position?
Regulatory Networks: What transcription factors and signaling pathways regulate the expression of NAD(P)H-quinone oxidoreductase genes in Acorus, and how do these compare with regulatory networks in other monocots?
Functional Adaptations: Has the NAD(P)H-quinone oxidoreductase complex in Acorus acquired specific functional adaptations for wetland environments, and if so, what are the molecular mechanisms underlying these adaptations?
Interaction with Photosystems: How does the interaction of NAD(P)H-quinone oxidoreductase with photosystems I and II in Acorus differ from that in other monocots, and what implications does this have for photosynthetic efficiency?
Post-translational Modifications: What role do post-translational modifications play in regulating NAD(P)H-quinone oxidoreductase activity in Acorus, and how do these modifications respond to environmental stimuli?
Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and evolutionary analyses. The answers will not only enhance our understanding of this specific enzyme system but also provide broader insights into early monocot evolution and adaptation .
Emerging technologies offer exciting opportunities to advance research on recombinant NAD(P)H-quinone oxidoreductase from Acorus:
CRISPR-Cas9 Genome Editing: Precise modification of NAD(P)H-quinone oxidoreductase genes in Acorus and other plant species will enable functional studies of specific residues and domains. This approach can help establish structure-function relationships and test hypotheses about evolutionary adaptations.
Single-Molecule Enzymology: Advanced techniques such as single-molecule fluorescence resonance energy transfer (smFRET) can provide unprecedented insights into the conformational dynamics and catalytic mechanism of NAD(P)H-quinone oxidoreductase, revealing aspects of enzyme function not accessible through bulk measurements.
Integrative Multi-omics: Combining genomics, transcriptomics, proteomics, and metabolomics approaches can provide a systems-level understanding of how NAD(P)H-quinone oxidoreductase functions within the broader context of cellular metabolism and stress responses in Acorus.
Artificial Intelligence and Machine Learning: These computational approaches can be applied to predict protein-protein interactions, identify regulatory elements, and model the effects of environmental variables on NAD(P)H-quinone oxidoreductase function, generating testable hypotheses for experimental validation.
Nanoscale Imaging Technologies: Techniques such as atomic force microscopy (AFM) and super-resolution microscopy can reveal the spatial organization and dynamics of NAD(P)H-quinone oxidoreductase complexes within chloroplast membranes, providing insights into their functional integration with other photosynthetic components.