Recombinant Acorus americanus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Acorus americanus psbB

The psbB gene encodes the CP47 chlorophyll apoprotein, a core component of Photosystem II (PSII) in plants. While Acorus calamus (sweet flag) has been studied for its photosynthetic proteins, Acorus americanus (American sweet flag) remains poorly characterized. The recombinant production of A. americanus psbB has not been documented in peer-reviewed literature or commercial databases (e.g., Creative Biomart, PubMed) as of the search cutoff. Below, we analyze the structural and functional context of psbB in related species and highlight gaps in A. americanus research.

Role in Photosystem II

CP47 (encoded by psbB) is a critical light-harvesting subunit in PSII, binding 16 chlorophyll a molecules and 4 β-carotene molecules. It stabilizes the PSII core complex and interacts with the oxygen-evolving enhancer (OEE) proteins .

FeatureDescriptionSource
Molecular Weight~56 kDa (predicted from nucleotide sequence)
Chlorophyll Binding16 Chl a and 4 β-carotene per subunit
Interaction PartnersD1/D2 reaction center, PsbH, PsbL, PsbT, PsbK, Psb30/Ycf12

Assembly and Biogenesis

CP47 binds to the D1/D2 reaction center early in PSII assembly, forming a preassembled complex with pigments. Its recruitment is essential for subsequent integration of the OEE proteins and cytochrome b559 .

Acorus calamus

While A. calamus psbB has not been explicitly studied, its genome reveals expansions in light-harvesting complexes (LHCs), including LHCB1, potentially linked to low-light adaptations . Recombinant A. calamus Photosystem II D2 protein (psbD) has been produced in E. coli for structural studies .

ParameterRecombinant A. calamus psbDRecombinant A. americanus psbB
Expression SystemE. coli with N-terminal His tagNot reported
Purity>90% (SDS-PAGE)N/A
ApplicationsStructural studies of PSII core complexN/A

Gaps in Acorus americanus Research

  1. Lack of Functional Data: No studies validate the recombinant production, pigment binding, or assembly role of A. americanus psbB.

  2. Phylogenetic Uncertainty: While Acorus species share genomic features (e.g., absence of τ whole-genome duplication) , A. americanus psbB remains uncharacterized.

  3. Structural Insights: Homology models could infer A. americanus psbB structure from Spinacia oleracea (P04160) or Lactuca sativa (Q332V1) sequences , but experimental validation is absent.

Proposed Research Directions

  1. Recombinant Expression: Cloning A. americanus psbB into E. coli or plant expression systems to study pigment binding and PSII integration .

  2. Phylogenetic Analysis: Comparing A. americanus psbB sequences with A. calamus and A. gramineus to identify conserved motifs or adaptations .

  3. Functional Assays: Testing A. americanus psbB’s role in PSII assembly using Synechocystis deletion mutants or Arabidopsis knockouts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Acorus americanus (Sweetflag) (Acorus calamus var. americanus)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47 is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a critical role in catalyzing the primary light-induced photochemical reactions of PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, producing O₂ and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Acorus americanus and why is it significant for photosynthesis research?

Acorus americanus (American Sweetflag) is a perennial rhizomatous monocot belonging to the Acoraceae family. This plant holds special evolutionary significance as Acorus represents the basal or sister lineage to all other monocot plants . The Acoraceae is viewed as the sister family to all other monocots, making proteins from this species particularly valuable for understanding the early evolution of photosynthetic mechanisms . Studying photosystem components from Acorus provides insights into ancestral photosynthetic machinery before the diversification of monocots. The plant can be found in wetland environments, typically reproducing vegetatively through its thick, branching rhizomes .

What are the optimal methods for isolating recombinant Acorus americanus psbB protein?

Isolation of recombinant A. americanus psbB protein requires careful consideration of protein structure and stability. The recommended methodology includes:

  • Expression System Selection: Utilizing a bacterial or yeast expression system optimized for membrane proteins. E. coli BL21(DE3) with modifications for membrane protein expression is commonly employed.

  • Buffer Optimization: The protein should be stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

  • Temperature Considerations: For extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing should be avoided. Working aliquots can be maintained at 4°C for up to one week .

  • Purification Strategy:

    • Initial extraction using detergent solubilization (typically n-dodecyl β-D-maltoside)

    • Metal affinity chromatography utilizing the recombinant tag

    • Size exclusion chromatography for final purification

    • Buffer exchange to remove imidazole and adjust glycerol concentration

The final product should be quantified and quality-controlled through SDS-PAGE and Western blotting to verify protein integrity and purity.

What spectroscopic methods are most effective for studying CP47 chlorophyll interactions?

Several spectroscopic techniques prove particularly valuable for studying CP47 chlorophyll interactions:

For high-resolution studies, quantum mechanics/molecular mechanics (QM/MM) approaches utilizing time-dependent density functional theory with range-separated functionals have proven effective in computing excitation energies of all CP47 chlorophylls . This computational approach can quantify the electrostatic effect of the protein on the site energies of CP47 chlorophylls.

How do the excitation energies of CP47 chlorophylls in Acorus americanus compare to other species?

Recent quantum mechanics/molecular mechanics (QM/MM) research has provided new insights into the excitation energies of CP47 chlorophylls in cyanobacterial PSII. While specific data for A. americanus is not fully characterized, comparable studies on cyanobacterial CP47 have revealed important patterns:

The ranking of site energies and the identity of the most red-shifted chlorophylls (B3, followed by B1) differ from previous hypotheses in the literature . This provides an alternative basis for evaluating past approaches and semiempirically fitted sets.

ChlorophyllPeak Absorption (nm)Relative Energy ShiftFunction in Energy Transfer
B3683-685Most red-shiftedTerminal energy acceptor
B1680-682Strongly red-shiftedMajor energy funnel
B5, B6675-678Moderately red-shiftedIntermediate energy transfer
B2, B4, B7670-673Minimally shiftedInitial energy capture
Others665-670Blue-shiftedPeripheral energy capture

These values are based on computational models of cyanobacterial PSII and may vary somewhat in A. americanus. A key research opportunity lies in determining if the ancestral position of Acorus in monocot evolution is reflected in different chlorophyll energy distributions compared to more derived plant groups.

What structural stability challenges must be addressed when working with isolated CP47?

When working with isolated CP47, including from A. americanus, several structural stability challenges must be addressed:

  • Membrane Protein Instability: As an integral membrane protein, CP47 requires careful handling to maintain its native structure outside the thylakoid membrane environment.

  • Isolation Effects: Molecular dynamics simulations of isolated CP47 reveal specific structural vulnerabilities compared to the protein in its native membrane-embedded state . These vulnerabilities must be addressed through stabilizing agents in experimental protocols.

  • Chlorophyll Retention: Maintaining the full complement of 16 chlorophyll molecules during isolation and purification is challenging. Loss of chlorophylls alters the protein's spectroscopic properties and functional characteristics.

  • Detergent Selection: The choice of detergent is critical for CP47 stability. Different detergents can affect protein conformation and chlorophyll binding differently.

  • Oxidative Damage: The protein and its bound chlorophylls are susceptible to oxidative damage during isolation, requiring oxygen-controlled environments and antioxidant additives.

Methodological approaches to address these challenges include:

  • Using mild detergents like n-dodecyl β-D-maltoside or digitonin

  • Including glycerol (typically 10-50%) as a stabilizing agent

  • Maintaining reducing conditions throughout purification

  • Performing procedures at 4°C with minimal light exposure

  • Utilizing lipid nanodiscs or amphipols for advanced structural studies

How can quantum mechanics/molecular mechanics approaches be applied to study CP47?

Quantum mechanics/molecular mechanics (QM/MM) approaches represent a powerful methodology for studying CP47 structure and function. These techniques can be applied through the following protocol:

  • Model Preparation:

    • Start with a high-resolution crystal structure of PSII

    • Embed the complex in a realistic membrane environment

    • Solvate with explicit water molecules and add counterions

    • Perform energy minimization and equilibration simulations

  • QM/MM Partitioning:

    • Treat individual chlorophylls and their immediate environment at the QM level

    • Handle the rest of the protein, membrane, and solvent at the MM level

    • Define appropriate QM/MM boundaries with link atoms or boundary potentials

  • Excited State Calculations:

    • Apply time-dependent density functional theory (TD-DFT) with range-separated functionals

    • Calculate vertical excitation energies for each chlorophyll

    • Account for electrostatic effects from the protein environment

    • Consider polarization effects through polarizable force fields

This approach has been successfully used to compute excitation energies of all CP47 chlorophylls in membrane-embedded cyanobacterial PSII dimer, providing a high-level quantum chemical excitation profile . The results quantify the electrostatic effect of the protein on the site energies of CP47 chlorophylls.

What does Acorus americanus psbB reveal about the evolution of photosynthesis in monocots?

Acorus americanus holds a unique position as part of the sister lineage to all other extant monocot plants . This makes its photosynthetic proteins, including psbB, valuable for understanding the early evolution of photosynthesis in monocots. Key evolutionary insights include:

The study of Acorus psbB provides a unique window into photosynthetic evolution before the major diversification of monocots, allowing researchers to trace the development of photosynthetic machinery throughout monocot evolution.

How do mutation rates in Acorus affect phylogenetic analysis of photosynthetic proteins?

Mutation rates in Acorus present significant challenges for phylogenetic analysis of photosynthetic proteins. Research has demonstrated:

  • Elevated Mitochondrial Mutation Rates: Although not directly measured for chloroplast genes, Acorus shows highly elevated mutation rates in mitochondrial genes compared to other angiosperms . This divergence occurred at the ancestral node of Acorus before intrageneric diversification.

  • Phylogenetic Implications: The high sequence divergence in Acorus can lead to its misplacement in single-gene phylogenetic trees . Similar challenges may exist for photosynthetic proteins.

  • Methodological Considerations: When conducting phylogenetic analyses that include Acorus photosynthetic proteins:

    • Use multiple genes rather than single-gene approaches

    • Apply models that account for heterogeneous substitution rates

    • Consider amino acid-based analyses rather than nucleotide-based analyses

    • Incorporate structural information to identify conserved functional domains

  • Gene-Specific Effects: Different photosynthetic genes may show different levels of sequence conservation. Some highly conserved genes (analogous to mitochondrial atp9 and cox1) may show depressed d/N values (<0.1), while others may fall in the range of 0.1–1 .

Researchers studying photosynthetic proteins must be aware of these elevated mutation rates in Acorus and implement appropriate analytical approaches to avoid phylogenetic artifacts.

What are the key considerations for designing expression vectors for recombinant Acorus americanus psbB?

Designing effective expression vectors for recombinant A. americanus psbB requires attention to several critical factors:

  • Codon Optimization: Analyze and optimize the Acorus psbB coding sequence for the expression host (typically E. coli or yeast) to improve translation efficiency.

  • Promoter Selection: Choose an appropriate promoter based on:

    • Expression level requirements (constitutive vs. inducible)

    • Host compatibility (bacterial vs. eukaryotic)

    • Induction characteristics (IPTG, arabinose, etc.)

  • Fusion Tags:

    • N-terminal vs. C-terminal positioning (C-terminal often preferred for membrane proteins)

    • Tag selection (His6, GST, MBP) based on purification strategy

    • Inclusion of protease cleavage sites for tag removal

  • Signal Sequences: Consider including a signal sequence for membrane targeting or secretion, depending on the expression system.

  • Chlorophyll Assembly: For functional studies, co-expression with chlorophyll synthesis genes or supplementation with chlorophyll precursors may be necessary.

A typical design strategy includes:

  • pET-based vector with T7 promoter for E. coli expression

  • C-terminal His6 tag with TEV protease cleavage site

  • Codon optimization for E. coli

  • Inclusion of chaperon co-expression to assist folding

What analytical techniques are most informative for validating recombinant psbB structure and function?

Multiple analytical techniques should be employed to thoroughly validate the structure and function of recombinant psbB:

For functional validation specifically, chlorophyll fluorescence lifetime measurements can determine if the recombinant protein exhibits the expected energy transfer characteristics. Comparison of these measurements with native protein preparations provides validation of functional integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.