Recombinant Acorus calamus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Acorus calamus (Sweet flag)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDKQLKQV LANGKKGSLNVGAVLILPEGFELAPPDRISPEMKEKMGNLAFQSYRPTKKNIIVIGPVPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGVVS RILRKEKGGYEITIADASDGHQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its function in Acorus calamus?

Apocytochrome f is a crucial component of the cytochrome b6-f complex involved in the photosynthetic electron transport chain in plants including Acorus calamus. The protein is encoded by the chloroplast gene petA and functions as an essential electron carrier between photosystem II and photosystem I. In its mature form after processing, cytochrome f contains a covalently attached heme group that facilitates electron transfer during photosynthesis. Within Acorus calamus specifically, this protein maintains the plant's energy production capabilities, which may contribute to the medicinal properties observed in various studies examining this plant's therapeutic potential . The study of recombinant forms of this protein allows researchers to investigate its structural and functional properties outside the complex cellular environment, providing insights into both basic photosynthetic mechanisms and potential biotechnological applications.

How does Recombinant Acorus calamus Apocytochrome f differ from related cytochrome proteins in the same plant?

Recombinant Acorus calamus Apocytochrome f differs from other cytochrome proteins such as Cytochrome b6-f complex subunit 4 (petD) primarily in structure, function, and genetic origin. While both are components of the cytochrome b6-f complex, Apocytochrome f (petA) is a larger subunit that anchors the complex to the thylakoid membrane and contains the primary electron transfer site, whereas petD (subunit 4) has a more structural role within the complex . The amino acid sequence and structural domains of Apocytochrome f contain specific electron transfer motifs not present in other cytochrome subunits. From a recombinant expression perspective, Apocytochrome f presents different challenges in solubility and proper folding compared to smaller cytochrome components like petD, which has a sequence of 160 amino acids as indicated in commercial products . Additionally, the post-translational modifications differ between these proteins, with Apocytochrome f requiring specific processing to become functionally active with its covalently bound heme group.

What are the optimal expression systems for producing functional Recombinant Acorus calamus Apocytochrome f?

The production of functional Recombinant Acorus calamus Apocytochrome f requires careful selection of expression systems that can accommodate the complex folding and post-translational requirements of this protein. Bacterial expression systems like E. coli often struggle with proper folding of plant chloroplast proteins, though specialized strains with enhanced disulfide bond formation capabilities can improve yield. Yeast expression systems (Pichia pastoris or Saccharomyces cerevisiae) often provide better folding environments for complex proteins from plants like Acorus calamus. Insect cell expression systems using baculovirus vectors represent another viable option that better accommodates the post-translational modifications needed for functional cytochrome proteins. For researchers seeking the most native-like protein structure, plant-based expression systems such as tobacco or Arabidopsis transient expression may be optimal, though with lower yields than microbial systems. The choice of expression system should be guided by the specific research questions being addressed, with structural studies typically requiring higher purity while functional studies may prioritize proper folding and cofactor incorporation.

How can Recombinant Acorus calamus Apocytochrome f be utilized in cancer research based on recent findings?

Recent research has demonstrated significant anticancer properties of Acorus calamus extracts, suggesting potential applications for its isolated protein components including Apocytochrome f. Studies have shown that A. calamus extracts inhibit exosome secretion in multiple breast cancer cell lines (HER2-positive, hormone receptor-positive, and triple-negative) by targeting key regulatory proteins Rab27a and nSMase2 . Recombinant Apocytochrome f could serve as a molecular tool to investigate whether this specific protein contributes to the observed anticancer effects or functions as a carrier for bioactive compounds like β-asarone, which comprises 71.13% of A. calamus essential oil . Researchers could develop experimental models where the recombinant protein is used to study interaction with cancer cell membranes or exosome formation pathways. Additionally, structural studies of Apocytochrome f might reveal binding sites for asarone compounds, potentially explaining some of the molecular mechanisms behind the observed inhibition of oncogenic proteins like heterogeneous nuclear ribonucleoprotein (hnRNP) A2/B1, which has been implicated in glioma progression . The recombinant protein could also be used to develop targeted delivery systems for anticancer compounds identified in A. calamus.

What structural and functional analyses can be performed with purified Recombinant Acorus calamus Apocytochrome f?

Purified Recombinant Acorus calamus Apocytochrome f enables numerous advanced structural and functional analyses crucial for understanding its biological role. X-ray crystallography and cryo-electron microscopy can reveal the detailed three-dimensional structure of the protein, including potential binding sites for cofactors or interacting partners that may explain A. calamus' therapeutic properties. Circular dichroism spectroscopy provides valuable information about secondary structure elements and conformational changes upon interaction with potential binding partners. For functional analyses, electron transfer assays using artificial electron donors and acceptors can measure the redox potential and electron transfer kinetics of the recombinant protein, which may correlate with the plant's observed biological activities. Surface plasmon resonance and isothermal titration calorimetry can be employed to quantitatively measure binding interactions between Apocytochrome f and compounds like β-asarone, which has demonstrated significant anticancer effects in studies of A. calamus . Additionally, reconstitution experiments with lipid membranes can assess how the protein functions in a membrane environment similar to its native state in the thylakoid membrane of chloroplasts.

How do mutations in the petA gene affect the functional properties of Apocytochrome f, and what research approaches can address this question?

Mutations in the petA gene can significantly impact the functional properties of Apocytochrome f, affecting electron transfer efficiency, protein stability, and interaction with other components of the photosynthetic apparatus. Site-directed mutagenesis of recombinant Acorus calamus petA gene constructs provides a powerful approach to systematically study how specific amino acid changes influence protein function. Key research approaches include creating a library of single or multiple point mutations targeting conserved residues involved in heme binding, electron transfer, or protein-protein interactions. Spectroscopic methods like UV-visible absorption, fluorescence spectroscopy, and electron paramagnetic resonance can then be used to characterize how these mutations affect the electronic properties of the heme center and electron transfer capabilities. In vitro reconstitution experiments with mutant and wild-type proteins can reveal differences in assembly with other components of the cytochrome b6-f complex. Computational molecular dynamics simulations comparing wild-type and mutant structures can predict changes in protein dynamics and stability that might explain altered function. Additionally, heterologous expression of mutant petA genes in model organisms lacking endogenous cytochrome f can assess the physiological consequences of these mutations on photosynthetic efficiency and growth.

What purification strategies yield the highest purity and activity of Recombinant Acorus calamus Apocytochrome f?

Purification of Recombinant Acorus calamus Apocytochrome f to obtain high purity and activity requires a multi-step approach tailored to its unique properties. Initial extraction typically employs gentle detergents like n-dodecyl-β-D-maltoside or digitonin to solubilize the membrane-associated protein without denaturing its structure. Immobilized metal affinity chromatography (IMAC) using a histidine tag is commonly the first chromatographic step, with optimization of imidazole concentration in washing and elution buffers being critical to reduce non-specific binding while maintaining protein stability. Ion exchange chromatography, particularly using anion exchangers, provides further purification by separating the protein based on its distinctive charge distribution profile. Size exclusion chromatography as a final polishing step separates monomeric active protein from aggregates and ensures removal of remaining contaminants. Throughout the purification process, maintaining reducing conditions (using agents like DTT or β-mercaptoethanol) preserves critical cysteine residues that are essential for proper folding and heme attachment. Activity assays monitoring electron transfer capability should be performed after each purification step to track recovery of functional protein, with typical yields of active protein ranging from 1-5 mg per liter of expression culture when optimized protocols are employed.

What analytical techniques are most effective for characterizing the structural integrity of Recombinant Acorus calamus Apocytochrome f?

The structural integrity of Recombinant Acorus calamus Apocytochrome f can be comprehensively assessed through multiple complementary analytical techniques. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content (α-helices, β-sheets) and can detect conformational changes resulting from different buffer conditions or interactions with binding partners. UV-visible absorption spectroscopy, particularly examining the characteristic Soret band (~410-420 nm) and Q bands (500-560 nm), offers critical insights into the environment and coordination state of the bound heme group, which is essential for functional activity. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) accurately determines the molecular weight and oligomeric state of the purified protein, revealing whether it exists as a monomer or forms functional dimers/oligomers. Differential scanning calorimetry (DSC) and thermal shift assays measure the thermal stability of the protein, identifying buffer conditions that optimize stability for long-term storage or crystallization attempts. Limited proteolysis followed by mass spectrometry mapping identifies flexible regions and stable domains, providing information about the folding integrity of different protein segments. Nuclear magnetic resonance (NMR) spectroscopy, while challenging for larger proteins, can provide atomic-level information about specific regions of interest, particularly when combined with selective isotopic labeling strategies.

How can researchers optimize expression conditions to increase yield of correctly folded Recombinant Acorus calamus Apocytochrome f?

Optimizing expression conditions for correctly folded Recombinant Acorus calamus Apocytochrome f requires systematic manipulation of multiple parameters affecting protein production and folding. Expression temperature significantly impacts folding, with lower temperatures (16-20°C) generally slowing protein synthesis and allowing more time for proper folding of complex proteins like Apocytochrome f. Induction strategies using lower concentrations of inducers (e.g., 0.1-0.5 mM IPTG for bacterial systems) can prevent overwhelming the cellular folding machinery while extending induction times to 16-24 hours. Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) has proven particularly effective for cytochrome proteins, helping to prevent aggregation and promoting correct folding pathways. Media composition optimization should include supplementation with δ-aminolevulinic acid (a heme precursor) at concentrations of 0.5-1.0 mM to support heme biosynthesis for incorporation into the apoprotein. For eukaryotic expression systems, codon optimization of the Acorus calamus petA gene sequence to match the codon bias of the host organism can significantly improve translation efficiency and yield. Implementing a design of experiments (DoE) approach allows systematic testing of multiple variables simultaneously (temperature, inducer concentration, media composition, and harvest time) to identify optimal combinations that maximize both yield and folding quality.

What role might Recombinant Acorus calamus Apocytochrome f play in the plant's documented antibacterial properties?

Recent research has demonstrated significant antibacterial activity in Acorus calamus essential oil, with particularly strong effects against Gram-positive bacteria such as Staphylococcus aureus (inhibition zone 20.11 ± 0.28 mm) and Bacillus subtilis (18.06 ± 1.36 mm), as well as moderate activity against Gram-negative bacteria like Pseudomonas aeruginosa and Escherichia coli . While β-asarone (71.13%) has been identified as the principal active compound in the essential oil, Apocytochrome f may play an indirect but significant role in the plant's antibacterial defense mechanisms. As a key component of the photosynthetic electron transport chain, Apocytochrome f contributes to energy production necessary for synthesizing secondary metabolites including β-asarone and α-asarone (12.07%), which directly mediate antibacterial effects. Researchers have hypothesized that certain peptide fragments derived from Apocytochrome f degradation may exhibit independent antimicrobial activity, similar to antimicrobial peptides identified in other photosynthetic proteins. Experimental approaches to investigate this connection include testing purified Recombinant Acorus calamus Apocytochrome f for direct antibacterial activity against various bacterial strains, examining potential synergistic effects between the protein and known antibacterial compounds from A. calamus, and exploring whether structural features of this specific protein variant contribute to enhanced production or stability of antibacterial metabolites within the plant.

How could Recombinant Acorus calamus Apocytochrome f be utilized to study the anticancer mechanisms identified in recent research?

Recent studies have revealed that Acorus calamus extracts inhibit cancer progression through multiple mechanisms, including downregulation of oncogenic proteins like heterogeneous nuclear ribonucleoproteins (hnRNP H1 and A2/B1), inhibition of exosome secretion via targeting Rab27a and neutral sphingomyelinase 2 (nSMase2), and modulation of cell cycle regulatory proteins . Recombinant Acorus calamus Apocytochrome f could serve as a valuable tool for dissecting these molecular mechanisms. Protein-protein interaction studies using techniques like pull-down assays, co-immunoprecipitation, or proximity ligation assays could determine whether Apocytochrome f directly interacts with cancer-relevant targets such as Rab27a or nSMase2, which were significantly downregulated by A. calamus treatment in breast cancer cells . Researchers could develop fluorescently tagged versions of the recombinant protein to track its cellular localization and potential co-localization with exosome secretion machinery components. Structure-function studies examining binding between Apocytochrome f and bioactive compounds like calcitriol lactone (which showed stable binding interactions with nSMase2) could reveal whether the protein serves as a carrier or stabilizer for these anticancer compounds . Additionally, comparative studies using Apocytochrome f variants from different A. calamus chemotypes could help explain the observed variation in anticancer efficacy across different cancer cell lines, such as the differential responses documented between HER2-positive, hormone receptor-positive, and triple-negative breast cancer cells.

What biochemical assays can measure the electron transfer activity of Recombinant Acorus calamus Apocytochrome f, and how should the data be interpreted?

Several specialized biochemical assays can accurately quantify the electron transfer activity of Recombinant Acorus calamus Apocytochrome f, providing critical insights into its functional state. The cytochrome c reduction assay serves as a primary method, where the rate of reduction of cytochrome c (monitored by absorbance change at 550 nm) directly correlates with electron transfer capability of Apocytochrome f. Typical values for fully active protein show initial reaction rates of 10-15 μmol cytochrome c reduced per minute per mg of Apocytochrome f at 25°C. Artificial electron donor/acceptor pairs such as methyl viologen and potassium ferricyanide can be used in cyclic voltammetry experiments to determine precise redox potentials, with functional Acorus calamus Apocytochrome f exhibiting characteristic midpoint potentials between +300 and +380 mV versus standard hydrogen electrode. Oxygen consumption assays using Clark-type electrodes measure electron transfer in reconstituted systems containing multiple components of the electron transport chain, with properly functioning Apocytochrome f showing oxygen consumption rates of 50-100 nmol O₂/min/mg protein. When interpreting these data, researchers should consider that values significantly below these benchmarks may indicate improper folding, heme incorporation issues, or oxidative damage to the protein. Temperature and pH dependence profiles of activity provide additional insights, with bell-shaped curves typically centered around pH 7.0-7.5 and temperature optima between 25-30°C reflecting the native conditions in chloroplasts.

Assay TypeMeasurement ParameterTypical Values for Active ProteinInterpretation Guidelines
Cytochrome c ReductionAbsorbance change at 550 nm10-15 μmol cyt c reduced/min/mgLinear kinetics indicate proper function; biphasic kinetics suggest heterogeneous protein population
Cyclic VoltammetryMidpoint potential+300 to +380 mV vs. SHESharp peaks indicate homogeneous redox centers; broad peaks suggest multiple conformations
Oxygen ConsumptionO₂ uptake rate50-100 nmol O₂/min/mgRates <30 nmol/min/mg indicate compromised function
Stopped-flow SpectroscopyElectron transfer rate constant10³-10⁴ s⁻¹Rate constants <10² s⁻¹ suggest structural perturbations
Heme Content AnalysisA₄₁₅/A₂₈₀ ratio2.8-3.2 for fully loaded proteinRatios <2.0 indicate incomplete heme incorporation

How can researchers differentiate between effects caused by Apocytochrome f versus other components in Acorus calamus extracts when studying anticancer properties?

Differentiating the specific contributions of Apocytochrome f from other bioactive components in Acorus calamus extracts requires a multifaceted experimental approach that isolates and validates individual effects. Fractionation studies represent the initial step, where plant extracts are separated using techniques like high-performance liquid chromatography (HPLC) or size exclusion chromatography to isolate protein fractions containing Apocytochrome f from fractions containing known bioactive compounds such as β-asarone (71.13%) and α-asarone (12.07%) . Each fraction should then be tested individually against cancer cell lines to establish baseline activity profiles. Recombinant Apocytochrome f can serve as a critical control in these experiments, allowing direct comparison between the purified protein and complex extract fractions. RNA interference or CRISPR-based knockout studies in cancer cell models can selectively inhibit potential target pathways like Rab27a and nSMase2 signaling, determining whether these pathways are necessary for Apocytochrome f activity versus asarone-mediated effects . Comparative proteomic analyses examining changes in protein expression patterns following treatment with either whole extracts, purified β-asarone, or Recombinant Apocytochrome f can identify shared versus distinct molecular targets. Research has already established that A. calamus treatment affects several cancer-relevant proteins including heterogeneous nuclear ribonucleoproteins and cell cycle regulators . Co-treatment experiments combining subthreshold concentrations of Apocytochrome f with other extract components can identify potential synergistic interactions that may explain why whole plant extracts often demonstrate greater efficacy than isolated compounds.

What computational approaches can predict interactions between Recombinant Acorus calamus Apocytochrome f and bioactive compounds from the plant?

Advanced computational approaches enable researchers to predict and characterize potential interactions between Recombinant Acorus calamus Apocytochrome f and bioactive compounds identified in the plant. Molecular docking simulations serve as the foundation of this approach, where the three-dimensional structure of Apocytochrome f (obtained through homology modeling based on crystallographic data from related species) is used to screen for potential binding sites for compounds like β-asarone, α-asarone, and calcitriol lactone. These simulations typically yield binding energy scores (ΔG values) ranging from -5 to -12 kcal/mol for significant interactions, with lower values indicating stronger predicted binding. Molecular dynamics (MD) simulations extend these findings by examining the stability and conformational changes of predicted protein-ligand complexes over nanosecond to microsecond timescales, revealing whether interactions remain stable in a dynamic environment. Quantum mechanical calculations focusing on the heme center of Apocytochrome f can predict how binding of bioactive compounds might influence the redox properties of the protein, potentially explaining some of the observed biological effects. Pharmacophore modeling approaches have successfully identified common structural features among compounds that bind to specific protein targets, which could help explain the overlapping anticancer mechanisms observed between different A. calamus components. Recent studies employing these computational approaches have already demonstrated that calcitriol lactone shows stable binding interactions with nSMase2, one of the key proteins downregulated by A. calamus extract in breast cancer cells .

What emerging technologies could advance the structural and functional understanding of Recombinant Acorus calamus Apocytochrome f?

Recent technological advances offer unprecedented opportunities to deepen our understanding of Recombinant Acorus calamus Apocytochrome f structure and function. Cryo-electron microscopy (cryo-EM) has revolutionized structural biology, potentially allowing visualization of Apocytochrome f in its native membrane environment or in complex with interaction partners without the need for crystallization, which has historically been challenging for membrane proteins. Time-resolved X-ray free-electron laser (XFEL) spectroscopy represents another cutting-edge approach that could capture the transient structural changes during electron transfer reactions of Apocytochrome f at femtosecond to picosecond timescales, providing insights into the dynamic aspects of function that remain inaccessible to static structural methods. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) coupled with high-resolution mass spectrometry offers a powerful approach to map protein dynamics and conformational changes upon interaction with binding partners or in different redox states, potentially revealing how Apocytochrome f structure relates to the medicinal properties of A. calamus. Artificial intelligence approaches, particularly AlphaFold2 and RoseTTAFold, have demonstrated remarkable accuracy in predicting protein structures and could help model species-specific variations in Apocytochrome f that might contribute to the unique bioactive properties observed in A. calamus. Single-molecule techniques like Förster resonance energy transfer (FRET) and atomic force microscopy (AFM) could track individual Apocytochrome f molecules during functional cycles, providing insights into conformational heterogeneity and rare states that are typically averaged out in bulk measurements.

How might gene editing approaches be used to study the relationship between Apocytochrome f variants and therapeutic properties in Acorus calamus?

Gene editing technologies offer powerful approaches to establish direct relationships between Apocytochrome f variants and the documented therapeutic properties of Acorus calamus. CRISPR-Cas9 mediated editing of the chloroplast petA gene could generate A. calamus plants with specific modifications to Apocytochrome f, creating a series of variants to test how amino acid changes affect the production of medicinal compounds like β-asarone and α-asarone. Targeted modifications could focus on regions predicted to influence protein-protein interactions or redox properties, potentially altering signaling pathways connected to the plant's anticancer and antibacterial activities. Transplastomic approaches, where the entire petA gene is replaced with variant versions in the chloroplast genome, would allow researchers to study how different natural variants of Apocytochrome f correlate with therapeutic efficacy across A. calamus populations worldwide. Inducible expression systems controlling petA expression levels could establish dose-dependent relationships between Apocytochrome f abundance and the concentration of medicinal compounds in plant tissues. Comparative metabolomic analysis of wild-type and edited plants would reveal how Apocytochrome f variants influence the broader metabolic network, particularly the biosynthetic pathways for key compounds like asarones that constitute over 83% of the essential oil . These approaches could ultimately enable the development of optimized A. calamus varieties with enhanced medicinal properties for specific therapeutic applications, such as cancer treatment where recent research has demonstrated significant activity against multiple cancer cell types .

What clinical research opportunities exist for Recombinant Acorus calamus Apocytochrome f based on recent discoveries about the plant's medicinal properties?

Recent discoveries about Acorus calamus' therapeutic properties open several promising avenues for clinical research involving its Recombinant Apocytochrome f protein. The documented ability of A. calamus extracts to inhibit exosome secretion in breast cancer cells by targeting Rab27a and nSMase2 suggests potential applications in combination cancer therapies . Clinical investigations could explore whether recombinant Apocytochrome f enhances the efficacy of standard chemotherapeutic agents by reducing tumor-derived exosome-mediated drug resistance, which represents a major challenge in treating aggressive cancers. Researchers could develop novel drug delivery systems using modified Apocytochrome f as a carrier for anticancer compounds like β-asarone, potentially improving targeted delivery to tumor cells while reducing systemic toxicity. Preliminary studies could establish whether recombinant protein administration elicits immune responses that might limit therapeutic applications, informing potential protein engineering strategies to reduce immunogenicity. The protein's documented effects on cell cycle regulators and apoptotic pathways warrant investigation into whether it could serve as a biomarker for treatment response in cancers treated with A. calamus-derived therapies . Translational research should also explore potential applications beyond cancer, including the antibacterial properties demonstrated against both Gram-positive and Gram-negative bacteria, which could address growing concerns about antibiotic resistance . As these clinical applications develop, researchers must address regulatory considerations regarding protein-based therapeutics derived from traditional medicinal plants, establishing standardized production and quality control protocols for consistent clinical outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.