Recombinant Acorus calamus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
atpI
Target Protein Sequence
MNVILCSSNMLKGLYDISGVEVGQHLYWQIGGFQVHAQVLITSWVVIAILLGSVTVAVRN PQTIPTNGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLI ELPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Acorus calamus ATP synthase subunit a (atpI) and its function in chloroplasts?

ATP synthase subunit a (atpI) is a key membrane protein component of the F0 sector of chloroplastic ATP synthase. This 247-amino acid protein forms part of the proton channel that allows proton translocation across the thylakoid membrane . The proton movement follows an electrochemical gradient established during photosynthesis and drives the rotation of the c-ring . This rotation is mechanically coupled to the F1 sector through a central stalk, leading to conformational changes in the catalytic sites that synthesize ATP from ADP and inorganic phosphate .

The specific structure of Acorus calamus atpI includes multiple transmembrane domains that anchor it within the thylakoid membrane, consistent with its role in forming the proton channel. Its amino acid sequence, as provided in product information, is: MNVILCSSNMLKGLYDISGYEVGQHLYWQIGGFQVHAQVLITSWVVIAILLGSVTVAVRN PQTIPTNGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKLI ELPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH .

How does atpI differ from other ATP synthase subunits?

AtpI (subunit a) serves a distinct role from other subunits in the ATP synthase complex. While subunit c forms a ring structure that rotates during proton translocation , subunit a remains stationary and provides half-channels for proton entry and exit. The interaction between subunits a and c is crucial for converting the proton gradient energy into mechanical rotation.

Unlike the c-subunit, which forms a multimeric ring (cn), subunit a exists as a single copy in the complex . The F0 region includes subunits a, b, b' and cn, while the F1 region contains the catalytic subunits α3, β3, γ, δ, and ε . Each component plays a specific role in the complex energy conversion process whereby proton translocation drives ATP synthesis.

What is the evolutionary significance of chloroplastic atpI?

The atpI gene is located in the Large Single Copy (LSC) region of the chloroplast genome, making it valuable for evolutionary studies . As part of the chloroplast genome, atpI reflects the endosymbiotic origin of chloroplasts from cyanobacteria, providing insights into the evolution of photosynthetic eukaryotes.

What methods are commonly used to study chloroplastic ATP synthase subunit a?

Several complementary approaches are used to study atpI:

  • Gene amplification and sequencing: Designing primers that target conserved regions flanking the atpI gene allows for its amplification and sequencing across different species or populations .

  • Recombinant protein expression: Similar to approaches used for other ATP synthase subunits, atpI can be expressed in bacterial systems using optimized codons and fusion partners to enhance solubility .

  • Immunological detection: Commercial antibodies and ELISA kits are available for detection and quantification of atpI .

  • Bioinformatic analysis: Comparative genomics and sequence analysis can reveal patterns of conservation and variation in atpI across species, informing its evolutionary history and functional constraints .

  • Structural characterization: Techniques like circular dichroism spectroscopy can be used to analyze the secondary structure of recombinant atpI, similar to approaches used for subunit c .

What are the challenges in expressing recombinant Acorus calamus atpI?

Expressing recombinant atpI presents several significant challenges:

  • Membrane protein solubility: As a hydrophobic membrane protein with multiple transmembrane domains, atpI tends to aggregate when expressed in aqueous environments. This often necessitates the use of fusion partners to enhance solubility, similar to the maltose binding protein (MBP) fusion strategy used for ATP synthase subunit c .

  • Host cell toxicity: Expression of membrane proteins can disrupt host cell membranes, potentially leading to toxicity. This may require co-expression with chaperone proteins (like DnaK, DnaJ, and GrpE) to facilitate proper folding and reduce toxicity, as demonstrated with other difficult-to-express proteins .

  • Proper folding: Ensuring that recombinant atpI adopts its native conformation is challenging. The protein's multiple transmembrane helices must fold correctly to achieve functional structure.

  • Purification complexity: Extracting and purifying membrane proteins often requires detergents or other solubilizing agents that can affect protein structure and function.

ChallengePotential SolutionConsideration
Poor solubilityFusion with MBP or other solubility enhancersMay affect protein function
Host toxicityCo-expression with chaperonesIncreases system complexity
MisfoldingMembrane-mimetic environmentsDetergent selection is critical
Low yieldCodon optimization for E. coliMay require extensive optimization
Purification difficultyAffinity tagsTag position can affect folding

How can site-directed mutagenesis of atpI be used to study ATP synthase function?

Site-directed mutagenesis of recombinant atpI offers powerful insights into ATP synthase function:

  • Proton pathway mapping: Mutations in residues proposed to line the proton half-channels can identify amino acids critical for proton translocation. By systematically altering conserved polar or charged residues, researchers can trace the path of proton movement through the F0 sector.

  • Subunit interface analysis: Mutations at the interfaces between atpI and other subunits (particularly c and b) can elucidate the structural basis of subunit interactions and complex assembly.

  • Species-specific adaptations: By comparing atpI sequences across species and introducing mutations that convert Acorus-specific residues to those found in other species, researchers can understand evolutionary adaptations in ATP synthase function.

  • Structure-function correlations: Based on structural predictions or homology models, strategic mutations can test hypotheses about structure-function relationships in atpI, particularly regarding how proton translocation is coupled to c-ring rotation.

  • Energy coupling efficiency: Mutations that alter the interaction between atpI and the rotating c-ring can provide insights into the efficiency of energy conversion from the proton gradient to mechanical rotation.

What bioinformatic approaches are most effective for analyzing atpI sequence data?

Effective bioinformatic analysis of atpI requires multiple complementary approaches:

  • Multiple sequence alignment: Comparison of atpI sequences across diverse plant species reveals patterns of conservation and variation. Tools like MUSCLE or MAFFT are particularly suitable for membrane proteins with conserved domains.

  • Phylogenetic analysis: Construction of phylogenetic trees based on atpI sequences can clarify evolutionary relationships among plant species. This approach has been successfully applied to other chloroplast genes .

  • Genetic diversity assessment: Calculation of nucleotide diversity (π) and identification of polymorphic sites (S) can quantify genetic variation within and between populations, similar to approaches used for other chloroplast loci .

  • Selection pressure analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) can identify regions under purifying selection (functional constraints) or positive selection (adaptive evolution).

  • Transmembrane topology prediction: Computational tools like TMHMM or Phobius can predict the membrane-spanning regions of atpI, informing structural and functional studies.

  • Coevolution analysis: Methods that detect correlated mutations can identify residues that interact functionally or structurally, providing insights into protein dynamics not evident from sequence alone.

How does variation in atpI affect ATP synthase efficiency in different environments?

Variations in atpI sequence across plant species and populations may represent adaptations to different environmental conditions:

The highly variable chloroplast markers identified in search result suggest that chloroplast genes do exhibit significant variation that may have adaptive significance.

What approaches can be used to study atpI-protein interactions?

Understanding how atpI interacts with other ATP synthase subunits is crucial for elucidating the function of the complete complex:

  • Crosslinking studies: Chemical crosslinkers can capture interactions between atpI and neighboring subunits, followed by mass spectrometry identification of interaction sites.

  • Co-immunoprecipitation: Using antibodies against atpI to pull down interacting partners from solubilized thylakoid membranes.

  • Yeast two-hybrid membrane system: Modified Y2H systems designed for membrane proteins can detect binary interactions between atpI and other subunits.

  • Förster resonance energy transfer (FRET): Fluorescently labeled atpI and potential interaction partners can be analyzed for energy transfer, indicating close proximity.

  • Bimolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to atpI and potential interaction partners can confirm interactions in vivo.

  • Surface plasmon resonance: Purified recombinant atpI can be immobilized to measure binding kinetics with other purified subunits.

  • Molecular dynamics simulations: Computational approaches can predict interaction interfaces and dynamics between atpI and other subunits in a membrane environment.

What expression systems are optimal for producing recombinant Acorus calamus atpI?

Several expression systems can be considered for recombinant atpI production, each with advantages and limitations:

  • E. coli with fusion partners: Expression as a fusion with solubility-enhancing partners like MBP (similar to the approach used for subunit c ), SUMO, or thioredoxin can improve yields and solubility. The fusion partner can later be removed by protease cleavage.

  • Co-expression with chaperones: As demonstrated for other difficult-to-express proteins, co-expression with chaperones like DnaK, DnaJ, and GrpE can significantly increase yields by promoting proper folding .

  • Specialized E. coli strains: C41(DE3) or C43(DE3) strains, which are adapted for membrane protein expression, may improve atpI production by reducing toxicity.

  • Cell-free expression systems: These bypass issues of cell toxicity and can directly incorporate atpI into liposomes or nanodiscs for functional studies.

  • Insect cell expression: Baculovirus-infected insect cells can produce eukaryotic membrane proteins with proper folding and post-translational modifications when needed.

Expression SystemAdvantagesDisadvantagesBest For
E. coli + MBP fusionHigh yield, easy purificationLarge fusion tagStructural studies
E. coli + chaperonesImproved foldingComplex systemDifficult constructs
C41/C43 E. coli strainsReduced toxicityLower yieldsToxic constructs
Cell-free systemDirect membrane incorporationExpensiveFunctional studies
Insect cellsEukaryotic processingTime-consumingComplex proteins

How can we design primers for efficient amplification of the atpI gene?

Designing effective primers for atpI amplification requires careful consideration of multiple factors:

  • Target conserved flanking regions: Examine sequence alignments of atpI and adjacent regions from multiple species to identify conserved areas suitable for primer design. This approach has been successful for other chloroplast genes in diverse plant taxa .

  • Primer properties optimization: Design primers with length 18-25 nucleotides, GC content 40-60%, and minimal self-complementarity or secondary structure formation. Ensure that primer pairs have similar melting temperatures (within 5°C).

  • Species-specific considerations: For Acorus calamus-specific primers, incorporate any unique sequence features while maintaining sufficient conservation for reliable amplification.

  • Amplicon length planning: Design primers to generate amplicons of appropriate size for the intended application (typically 400-1000 bp for Sanger sequencing).

  • Degenerate positions: If designing primers for use across multiple species, consider incorporating degenerate nucleotides at positions that show variation.

The approach used in search result , which successfully designed chloroplast DNA primers for monocot species (including Acorus calamus), provides a useful model. Their methodology of aligning sequences from multiple species to identify conserved regions flanking variable targets would be directly applicable to atpI primer design.

What purification strategies yield the highest quality recombinant atpI?

Effective purification of recombinant atpI requires strategies optimized for membrane proteins:

  • Affinity chromatography: Initial capture using fusion tags like MBP (as in search result ) or His-tag allows specific isolation from bacterial lysates.

  • Detergent solubilization: Selection of appropriate detergents (e.g., DDM, LDAO, or C12E8) is critical for maintaining protein stability while extracting it from membranes.

  • Tag removal: Site-specific proteases (e.g., TEV or PreScission) can cleave fusion tags to obtain native atpI, though this step may reduce yield.

  • Size exclusion chromatography: This separates monomeric atpI from aggregates and removes detergent micelles, providing information about the oligomeric state.

  • Ion exchange chromatography: Additional purification based on charge properties can remove contaminants with similar size but different charge.

  • Quality assessment: Multiple methods should confirm purity and structural integrity, including SDS-PAGE, western blotting with specific antibodies, and circular dichroism to verify secondary structure (similar to approaches used for subunit c ).

The specific purification strategy should be tailored to the downstream application, with structural studies typically requiring higher purity than functional assays.

What analytical techniques best characterize the structure of recombinant atpI?

Structural characterization of recombinant atpI requires complementary techniques:

  • Circular dichroism spectroscopy: As used for subunit c in search result , CD can confirm the expected alpha-helical secondary structure of atpI and monitor thermal stability.

  • Cryo-electron microscopy: Increasingly the method of choice for membrane protein structures, cryo-EM can determine the structure of atpI alone or within the ATP synthase complex.

  • Cross-linking mass spectrometry: This can identify contact points between atpI and other subunits or within different regions of atpI itself.

  • Hydrogen-deuterium exchange mass spectrometry: HDX-MS can map solvent-accessible regions and conformational dynamics.

  • Solid-state NMR: For membrane proteins reconstituted in lipid bilayers, solid-state NMR can provide atomic-level structural information.

  • Molecular dynamics simulations: These can model atpI behavior in membrane environments and predict functional movements during proton translocation.

  • Small-angle X-ray scattering: SAXS provides low-resolution structural information about shape and dimensions in solution.

Each technique has strengths and limitations, necessitating an integrated approach for comprehensive structural characterization.

How can we assess the functional integrity of recombinant atpI?

Assessing functional integrity of recombinant atpI presents unique challenges since it functions as part of a complex:

  • Reconstitution assays: Incorporating recombinant atpI into liposomes along with other ATP synthase subunits to measure proton translocation or ATP synthesis.

  • Proton conductance measurements: In reconstituted systems, measuring pH changes or using fluorescent pH indicators to detect proton movement across membranes containing atpI.

  • Binding studies: Assessing interactions with known binding partners (particularly subunits c and b) using techniques like surface plasmon resonance or pull-down assays.

  • Complementation studies: Testing if recombinant atpI can rescue function in mutant systems lacking functional atpI.

  • Structural integrity markers: Employing biophysical techniques like circular dichroism to confirm proper folding, similar to the approach used for subunit c .

  • Conformational antibodies: Using antibodies that recognize specific conformational epitopes to verify proper folding.

A comprehensive functional assessment would ideally combine multiple approaches to evaluate different aspects of atpI function.

How do we interpret variable sites in atpI sequences from different populations?

Interpretation of sequence variation in atpI requires careful analysis:

The functional significance of variations would be evaluated based on their potential effects on protein structure, proton channeling efficiency, or interactions with other ATP synthase subunits.

What statistical approaches are most appropriate for analyzing atpI polymorphisms?

Statistical analysis of atpI polymorphisms requires methods suited to chloroplast sequence data:

  • Diversity indices: Calculate nucleotide diversity (π), number of polymorphic sites (S), and haplotype diversity (Hd) to quantify genetic variation within and between populations .

  • Population differentiation metrics: FST and related statistics can quantify genetic differentiation between populations or species.

  • Neutrality tests: Tajima's D, Fu's Fs, or the McDonald-Kreitman test can detect signatures of selection versus neutral evolution.

  • Phylogenetic methods: Maximum likelihood, Bayesian inference, or distance-based methods can reconstruct evolutionary relationships based on atpI sequences.

  • Analysis of Molecular Variance (AMOVA): This approach partitions genetic variation within and among populations or geographic regions.

  • Mantel tests: These can detect correlations between genetic distances and geographic distances, revealing patterns of isolation by distance.

  • Bayesian clustering: Programs like STRUCTURE can infer population structure from genetic data without prior geographic information.

The choice of statistical methods should be guided by the specific research questions and sampling design.

How can atpI sequence data contribute to phylogenetic studies?

AtpI sequence data can make significant contributions to plant phylogenetics:

  • Species delimitation: In taxonomically complex groups, atpI sequences can help define species boundaries, especially when combined with other chloroplast markers.

  • Genus-level relationships: AtpI can resolve relationships among closely related genera where more conserved markers lack sufficient variation.

  • Maternal lineage tracing: Since chloroplasts are typically maternally inherited in angiosperms, atpI sequences trace maternal lineages in hybridization or polyploidization events.

  • Biogeographic analysis: Phylogenetic patterns based on atpI can inform hypotheses about historical plant migrations and range expansions.

  • Molecular dating: When calibrated with fossil evidence, atpI-based phylogenies can estimate divergence times between lineages.

  • Chloroplast capture detection: Incongruence between atpI and nuclear gene phylogenies may indicate chloroplast capture through hybridization.

The moderate evolutionary rate of atpI makes it particularly suitable for resolving relationships at intermediate taxonomic levels (between species and families), complementing faster-evolving markers like trnH-psbA or slower-evolving ones like rbcL .

How do we reconcile contradictory data from different analytical methods?

When faced with contradictory data about atpI from different methods, researchers should:

  • Evaluate methodological limitations: Each analytical technique has inherent limitations and assumptions that may explain contradictions.

  • Consider biological complexity: Contradictions may reflect actual biological phenomena, such as heteroplasmy (multiple chloroplast genomes within an individual) or recent hybridization.

  • Design validation experiments: Target specific contradictions with experiments designed to directly resolve them, using orthogonal methods.

  • Apply integrative approaches: Statistical frameworks that can simultaneously incorporate different data types may resolve apparent contradictions.

  • Assess sample quality issues: Some contradictions may result from DNA quality problems, contamination, or amplification biases.

  • Consider evolutionary rate variation: Different regions of atpI may evolve at different rates, leading to conflicting signals in different analyses.

  • Examine alignment ambiguities: For sequence-based contradictions, multiple alignment algorithms should be compared to identify alignment-dependent results.

Contradictions often highlight areas where current understanding is incomplete, potentially leading to new insights about atpI evolution or function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.