Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAILEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPLGLFTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for this recombinant protein?

Proper storage and handling of Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 is crucial for maintaining its structural integrity and biological activity. Based on standard protocols, researchers should adhere to the following guidelines:

Storage ConditionRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol
Freeze-thaw cyclesMinimize; repeated freezing and thawing is not recommended

It's advisable to prepare small working aliquots to avoid multiple freeze-thaw cycles that can compromise protein stability and activity .

How can researchers verify the identity and purity of the recombinant protein?

Verification of protein identity and purity is essential before conducting experiments. Recommended analytical methods include:

  • SDS-PAGE analysis: Confirms molecular weight (~17 kDa) and purity (should be >85% as reported for commercial preparations)

  • Western blotting: Using antibodies specific to Cytochrome b6-f complex subunit 4 or to the tag used in the recombinant construct

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Circular dichroism: To assess proper protein folding and secondary structure

Researchers should also validate the protein's UniProt number (Q3V503) to ensure they are working with the correct sequence from Acorus calamus .

What expression systems are typically used for producing this recombinant protein?

The recombinant Acorus calamus Cytochrome b6-f complex subunit 4 is commonly expressed in E. coli expression systems. This bacterial expression platform offers several advantages including:

  • High protein yield

  • Relatively simple culture conditions

  • Cost-effectiveness for research-scale production

  • Well-established protocols for induction and purification

The expression region typically encompasses amino acids 1-160, representing the full-length protein. The tag type used for purification is generally determined during the production process based on the specific research requirements .

How does the amino acid sequence of Acorus calamus petD compare with homologous proteins from other species?

Comparative sequence analysis of Cytochrome b6-f complex subunit 4 across different species reveals important evolutionary relationships and conserved functional domains. When comparing the Acorus calamus petD sequence with that of other species such as Amphidinium carterae, several patterns emerge:

SpeciesSequence SimilarityKey DifferencesUniProt ID
Acorus calamusReferenceContains unique MGVTKKPDLNDPVLRAKLAKGMGH motifQ3V503
Amphidinium carterae~65-70%Has MVVRLPYVKGSILCSALAKGCGH variant motifQ1HCL0

The conserved regions typically include the transmembrane domains and sites involved in electron transport, while the variable regions may reflect evolutionary adaptations to different photosynthetic environments .

A phylogenetic analysis of chloroplast genomes indicates that the petD gene is part of a conserved gene cluster in photosynthetic organisms, making it valuable for taxonomic studies and evolutionary research .

What methodological approaches are most effective for studying the functional properties of Cytochrome b6-f complex subunit 4?

Investigating the functional properties of Cytochrome b6-f complex subunit 4 requires specialized techniques that can assess its role in electron transport and protein-protein interactions. Recommended methodological approaches include:

  • Electron transport assays:

    • Measure electron transfer rates using artificial electron donors and acceptors

    • Employ spectrophotometric techniques to monitor reduction-oxidation states

  • Reconstitution studies:

    • Incorporate the purified protein into liposomes

    • Assess functionality in a controlled membrane environment

  • Site-directed mutagenesis:

    • Introduce specific mutations to identify critical amino acid residues

    • Analyze the impact on electron transport efficiency and complex assembly

  • Protein-protein interaction studies:

    • Use co-immunoprecipitation to identify binding partners

    • Apply crosslinking techniques to capture transient interactions

    • Employ fluorescence resonance energy transfer (FRET) to examine spatial relationships

  • Structural biology approaches:

    • X-ray crystallography for high-resolution structural analysis

    • Cryo-electron microscopy for visualization of the entire complex

How can the recombinant protein be used in ELISA-based experimental designs?

The recombinant Acorus calamus Cytochrome b6-f complex subunit 4 can be effectively utilized in ELISA-based experiments to study protein-protein interactions, detect antibodies, or quantify expression levels. A methodological approach includes:

  • Direct ELISA protocol:

    • Coat microplate wells with optimized concentration of recombinant protein (typically 1-10 μg/mL)

    • Block non-specific binding sites with 3-5% BSA or non-fat milk

    • Incubate with primary antibody (if detecting antibodies against the protein) or potential binding partners

    • Detect using enzyme-conjugated secondary antibodies and appropriate substrate

  • Sandwich ELISA optimization:

    • Use capture antibodies specific to the protein or its tag

    • Apply the recombinant protein as a standard for quantification

    • Develop standard curves using serial dilutions (0.1-1.0 mg/mL)

    • Add 5-50% glycerol to standards to match sample buffer conditions

  • Competition ELISA applications:

    • Pre-incubate samples with the recombinant protein

    • Assess competitive binding to target molecules

    • Calculate inhibition percentages to determine binding affinity

Researchers should validate all ELISA protocols with appropriate positive and negative controls to ensure specificity and sensitivity .

What is the relationship between Cytochrome b6-f complex research and the medicinal properties of Acorus calamus?

While the Cytochrome b6-f complex subunit 4 is primarily associated with photosynthetic function, understanding this protein may provide insights into the broader biochemical profile of Acorus calamus that contributes to its therapeutic properties. Current research indicates:

  • Antioxidant properties:

    • Photosynthetic proteins like those in the Cytochrome b6-f complex can contribute to the plant's ability to manage reactive oxygen species

    • Research shows Acorus calamus extracts possess significant antioxidant activity that protects against social isolation stress-induced oxidative damage in rat brain tissue

  • Medicinal applications of Acorus calamus:

    • Traditional uses include treatment for neurological, metabolic, and respiratory disorders

    • Modern research has validated antidepressant, anti-inflammatory, and neuroprotective effects

    • The plant has demonstrated potential in treating:

      • Cognitive deficits and depression

      • Various cancers through anti-tumor and chemopreventive activities

      • Viral infections including potential activity against SARS-CoV-2 proteases

  • Molecular targets identified in research:

Bioactive ComponentTarget/ActivityDisease ModelReference
β-asarone↓ P-glycoprotein expression
↓ MDR1 mRNA expression
Glioblastoma (U251 cells)
β-asarone↑ Autophagic markers (Beclin-1, LC3-II/I)
↓ p62 expression
Glioblastoma
β-asarone↑ Proapoptotic proteins (Bax)
↓ Antiapoptotic regulators (Bcl-2, Bcl-xL)
Colon cancer (LoVo cells)
A. calamus compoundsInhibition of SARS-CoV-2 PLpro and MproIn vitro enzymatic assays

Although the direct role of petD in these medicinal properties remains to be established, studying recombinant proteins from this plant contributes to our comprehensive understanding of its biochemical profile and potential therapeutic applications .

What challenges might researchers encounter when working with this recombinant protein, and how can they be addressed?

Researchers working with Recombinant Acorus calamus Cytochrome b6-f complex subunit 4 may encounter several technical challenges that require specific strategies to overcome:

  • Protein solubility issues:

    • Challenge: Membrane proteins like those in the Cytochrome b6-f complex often have hydrophobic regions that reduce solubility

    • Solution: Optimize buffer conditions with appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) to maintain the protein in solution without denaturing it

  • Maintaining native conformation:

    • Challenge: Ensuring the recombinant protein adopts its functional three-dimensional structure

    • Solution: Consider expression systems that support proper folding and post-translational modifications; include proper cofactors in buffer solutions

  • Stability during experimental procedures:

    • Challenge: Protein degradation during extended protocols

    • Solution: Work at 4°C when possible, add protease inhibitors to buffers, and minimize freeze-thaw cycles as recommended in storage protocols

  • Reconstitution of lyophilized protein:

    • Challenge: Incomplete solubilization after reconstitution

    • Solution: Follow manufacturer recommendations to centrifuge vials before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol for long-term storage

  • Functional assays in isolation:

    • Challenge: The protein functions as part of a complex in vivo

    • Solution: Consider reconstitution approaches with other components of the Cytochrome b6-f complex or use model membrane systems

How can this protein be used in research related to photosynthetic efficiency and plant adaptations?

The recombinant Acorus calamus Cytochrome b6-f complex subunit 4 offers valuable opportunities for investigating photosynthetic mechanisms and plant adaptations:

  • Structure-function relationship studies:

    • Compare petD sequences across species adapted to different light environments

    • Identify adaptive mutations that optimize electron transport under various conditions

    • Correlate structural variations with photosynthetic efficiency parameters

  • Climate change adaptation research:

    • Investigate how variations in the Cytochrome b6-f complex affect responses to elevated temperatures or CO2 levels

    • Develop models predicting photosynthetic adaptation potential in changing environments

  • Genetic engineering applications:

    • Use sequence information from Acorus calamus petD to design modifications that could enhance photosynthetic efficiency

    • Create chimeric proteins combining beneficial features from different species

  • Synthetic biology approaches:

    • Reconstruct minimal photosynthetic units incorporating optimized components

    • Test hypotheses about rate-limiting steps in electron transport using modified proteins

  • Biophysical investigations:

    • Measure electron transfer rates through the complex using spectroscopic techniques

    • Assess how specific amino acid substitutions affect energy transfer efficiency

This research has implications for improving crop productivity, understanding evolutionary adaptations in photosynthetic organisms, and potentially developing more efficient artificial photosynthetic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.