Recombinant Acorus calamus NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice delivery is required, please notify us in advance as an additional fee may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
ndhA
Target Protein Sequence
MIIATTEIQAINSFSRSESLSLKEVYGLIWLLVPIFTLILVIIIGVLVIVWLEREISAGI QQRIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDISLFSLGPSIAVISTLLSYLVIPF GYHLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFSGGLRAAAQSISYEIPLTLC VLSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFLVFLVSSLAECERLPFDLPEAEE ELVAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFIPELFGKNKTG GIFGMTIGILITLAKAYLFLFISIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSS QLVSL
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's immediate electron acceptor. The enzyme couples the redox reaction with proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) and what role does it play in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) is a critical component of the chloroplast NAD(P)H dehydrogenase complex involved in cyclic electron flow around photosystem I. Studies of chloroplastic ndhA genes show they encode highly conserved peptides that undergo specific C-to-U RNA editing at internal mRNA positions to restore evolutionarily conserved amino acids essential for protein function . The ndhA protein participates in electron transport chains within chloroplasts, contributing to ATP synthesis and maintaining redox balance in plant cells. In Acorus calamus, this protein likely plays similar roles while potentially exhibiting species-specific adaptations related to the plant's unique metabolic profile.

How does the Acorus calamus ndhA compare to homologous genes in other plant species?

While specific comparative studies of ndhA in Acorus calamus versus other plants aren't directly reported in current literature, inferences can be made based on patterns observed in other species. In maize, for example, the ndhA gene encodes a peptide with highly conserved regions shared across multiple plant species . Alignment with homologous mitochondrial NADH-ubiquinone reductase subunit 1 (nad1) sequences shows that some editing sites restore universally conserved amino acids .

Given the molecular diversity observed in different A. calamus genotypes (with 24.71% polymorphism across genotypes) , researchers should expect:

  • Conservation of functionally critical regions

  • Variation in less constrained domains

  • Potential species-specific RNA editing patterns

  • Possible correlation between ndhA sequence variations and different medicinal properties observed in various genotypes

What unique characteristics make Acorus calamus valuable for ndhA research?

Acorus calamus presents several distinctive attributes that make it particularly valuable for ndhA research:

  • Significant genetic diversity across geographical regions, with molecular analysis revealing 24.71% polymorphism across genotypes , providing a natural laboratory for studying gene variation.

  • High content of bioactive compounds with substantial variation between genotypes:

    • α-asarone content ranging from 0.83% to 16.82%

    • β-asarone content ranging from 65.96% to 92.12%

  • Documented medicinal properties including neuroprotective, antidiabetic, antioxidant, and anti-inflammatory effects , which may relate to chloroplast function.

  • Traditional uses in multiple medical systems, including Ayurvedic medicine where it's known as "vacha," meaning "to speak," reflecting its applications in voice-related treatments .

These characteristics create opportunities to study how chloroplastic gene function might correlate with medicinal properties and adaptation to different environments.

What are the key considerations for expressing recombinant Acorus calamus ndhA in heterologous systems?

When expressing recombinant ndhA from Acorus calamus, researchers should address several critical factors:

  • RNA editing patterns: C-to-U editing at specific sites is necessary to restore conserved amino acids, as demonstrated in maize ndhA . Consider using edited cDNA sequence rather than genomic DNA to obtain functional protein.

  • Expression system selection: Plant chloroplast proteins may require specific conditions for proper folding and function. Consider chloroplast-mimicking expression systems or the addition of appropriate chaperones.

  • Potential interactions: A. calamus extracts have demonstrated interactions with cytochrome P450 enzymes including CYP3A4 and CYP2D6 , which might affect experimental design in certain contexts.

  • Genotype selection: Given the significant variation between A. calamus genotypes (α-asarone: 0.83-16.82%, β-asarone: 65.96-92.12%) , carefully document and report the specific genotype used as source material.

  • Protein solubility: As a membrane-associated protein, ndhA may require optimization with detergents or fusion partners to maintain solubility during expression and purification.

How do RNA editing mechanisms affect ndhA transcript processing in Acorus calamus?

RNA editing represents a crucial post-transcriptional modification process for chloroplastic ndhA. While specific editing patterns in Acorus calamus ndhA remain to be fully characterized, insights from other species provide important context:

  • In maize, ndhA transcripts undergo C-to-U editing at four specific sites, which restores evolutionarily conserved amino acids essential for protein function .

  • This editing affects internal mRNA positions rather than just transcript termini, representing a significant regulatory mechanism .

  • Some editing sites restore universally conserved amino acids found across plant and even non-plant species , indicating their functional importance.

In the context of A. calamus genetic diversity (24.71% polymorphism across genotypes) , researchers should investigate:

  • Potential variation in RNA editing efficiency between genotypes

  • Correlation between editing patterns and medicinal compound production

  • Environmental factors that may influence editing rates

  • Tissue-specific differences in editing patterns

What methodological approaches can identify structural differences in ndhA proteins from various Acorus calamus genotypes?

To characterize structural differences in ndhA proteins across A. calamus genotypes, researchers should employ multiple complementary approaches:

  • Sequence analysis: Compare amino acid sequences derived from cDNA (post-editing) rather than genomic DNA to identify true protein variations.

  • Homology modeling: Generate structural models based on known crystal structures of homologous proteins from other species.

  • Recombinant protein expression and purification: Express proteins from different genotypes under identical conditions to enable direct structural comparisons.

  • Circular dichroism spectroscopy: Assess secondary structure content and stability under varying conditions.

  • Limited proteolysis: Identify regions with differential accessibility that may reflect structural variations.

  • Activity assays: Correlate structural differences with functional parameters, particularly in genotypes with varying levels of α-asarone (0.83-16.82%) and β-asarone (65.96-92.12%) .

Such comparative analyses would provide valuable insights into how genetic diversity translates to functional diversity across A. calamus genotypes from different geographical regions.

What techniques are most effective for analyzing ndhA gene expression in different tissues of Acorus calamus?

For comprehensive analysis of ndhA expression across different Acorus calamus tissues, researchers should implement a multi-faceted approach:

TechniqueKey ConsiderationsAdvantages
Quantitative RT-PCRDesign primers to distinguish edited from unedited transcripts; use multiple reference genes for normalizationHigh sensitivity; relatively low cost; good for comparative analysis
RNA-SeqAccount for post-transcriptional modifications; integrate with metabolomic dataProvides transcriptome-wide context; identifies co-expression networks
Northern blottingUseful for detecting alternative transcript formsVisualizes transcript size; confirms specificity
Western blottingRequires specific antibodies; may need optimization for membrane proteinsConfirms translation; reveals protein abundance
ImmunohistochemistryRequires specific antibodies; fix tissues appropriatelyProvides spatial localization within tissues

Researchers should particularly focus on correlating expression patterns with medicinal properties of specific tissues, as A. calamus demonstrates diverse therapeutic effects including neuroprotective, antidiabetic, and anti-inflammatory activities . Additionally, comparing expression across genotypes with varying levels of bioactive compounds may reveal important regulatory relationships.

What are the optimal methods for purifying recombinant ndhA protein from Acorus calamus for structural studies?

For successful purification of recombinant ndhA protein suitable for structural studies, researchers should consider this methodological workflow:

  • Expression system selection:

    • E. coli strains designed for membrane proteins (e.g., C41/C43)

    • Insect cell systems for improved folding of plant proteins

    • Use codon-optimized sequences reflecting RNA-edited transcripts

  • Affinity tag strategy:

    • C-terminal tags often preferable for membrane proteins

    • Consider cleavable tags to obtain native protein for structural studies

    • Validate tag position doesn't interfere with function

  • Membrane protein extraction:

    • Optimize detergent selection (mild detergents like n-dodecyl β-D-maltoside)

    • Consider nanodiscs or amphipols for maintaining native-like environment

    • Test multiple solubilization conditions

  • Purification protocol:

    • Multi-step approach: affinity chromatography followed by size exclusion

    • Include reducing agents to maintain cysteine residues

    • Optimize buffer composition based on protein stability

  • Quality control:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to assess stability

    • Activity assays to confirm function

Researchers should be aware of potential interactions with cytochrome P450 enzymes, as Acorus calamus extracts interact with CYP3A4 and CYP2D6 , which might affect experimental design when studying recombinant ndhA function.

What experimental approaches can determine how ndhA function relates to medicinal properties of Acorus calamus?

To establish relationships between ndhA function and the medicinal properties of Acorus calamus, researchers should pursue several complementary experimental approaches:

  • Comparative studies across genotypes:

    • Correlate ndhA sequence variants/expression levels with:

      • α-asarone content (0.83-16.82% variation between genotypes)

      • β-asarone content (65.96-92.12% variation between genotypes)

      • Medicinal efficacy in standardized assays

  • Functional modulation experiments:

    • RNA interference to reduce ndhA expression

    • Heterologous expression of variant ndhA proteins

    • Analysis of effects on bioactive compound synthesis

  • Metabolic pathway analysis:

    • Trace isotope-labeled precursors through chloroplast metabolism to bioactive compounds

    • Identify metabolic bottlenecks influenced by ndhA activity

    • Measure NAD(P)H/NAD(P)+ ratios in different tissues and genotypes

  • Stress response experiments:

    • Challenge plants with oxidative stressors

    • Measure ndhA activity and correlate with production of protective compounds

    • Test neuroprotective capabilities against acrylamides in relation to ndhA function

  • Structure-function analysis:

    • Identify specific domains in ndhA that correlate with particular medicinal properties

    • Engineer chimeric proteins to test domain-specific functions

These approaches would help elucidate whether ndhA primarily contributes to medicinal properties through general metabolic support or through more specific regulatory interactions.

How should researchers interpret ndhA sequence variations between Acorus calamus genotypes?

When analyzing ndhA sequence variations between Acorus calamus genotypes, researchers should apply these interpretive frameworks:

  • Evolutionary conservation analysis:

    • Identify regions conserved across plant species, which likely have critical functional roles

    • Compare to maize ndhA where four C-to-U editing sites restore conserved amino acids

    • Distinguish between core functional domains and more variable regions

  • Structure-function correlation:

    • Map variations to predicted protein domains

    • Assess whether changes occur in membrane-spanning regions, cofactor binding sites, or interface regions

  • Geographical pattern analysis:

    • Consider the "high genetic differentiation among genotypes from the same localities"

    • Evaluate whether variations correlate with environmental adaptations

    • Recognize that clustering patterns of genotypes "did not show any specific correlation with their geographical provenances"

  • Association with bioactive compounds:

    • Correlate specific ndhA variants with levels of α-asarone (0.83-16.82%) and β-asarone (65.96-92.12%)

    • Assess whether sequence variations affect pathways leading to these compounds

  • RNA editing implications:

    • Determine whether variations affect potential RNA editing sites

    • Compare genomic DNA sequences with cDNA to identify actual editing events

Functional validation through recombinant protein expression and activity assays remains essential to confirm the significance of observed sequence differences.

What statistical approaches are most appropriate for analyzing ndhA expression data across different Acorus calamus genotypes?

For robust analysis of ndhA expression data across Acorus calamus genotypes, researchers should employ these statistical approaches:

Statistical MethodApplication ScenarioKey Considerations
Mixed linear modelsComparing expression across genotypesIncorporate genotype as random effect; account for 24.71% polymorphism
Multiple regressionRelating expression to bioactive compound levelsInclude environmental factors as covariates; test for interaction effects
ANCOVAComparing expression while controlling for confounding variablesUse when comparing genotypes grown under different conditions
Principal Component AnalysisPattern identification in complex datasetsIntegrate expression, metabolite, and phenotypic data
Hierarchical clusteringIdentifying genotype groups with similar expression patternsUse appropriate distance metrics based on data distribution
Permutation testsAddressing small sample sizesUseful when parametric assumptions cannot be met

Researchers should pay particular attention to:

  • Accounting for RNA editing when quantifying expression

  • Distinguishing technical from biological variation

  • Appropriate multiple testing correction given the genetic diversity observed

  • Potential non-linear relationships between expression and metabolite levels

How can contradictory findings about ndhA function in Acorus calamus be reconciled?

When facing contradictory findings regarding ndhA function in Acorus calamus, researchers should systematically consider these potential sources of discrepancy:

  • Genotypic differences:

    • Studies may use genotypes with varying ndhA sequences or expression patterns

    • The 24.71% polymorphism across genotypes and high genetic differentiation even among genotypes from the same localities may explain functional differences

  • Methodological variations:

    • Different protein isolation techniques may affect observed activity

    • Variation in assay conditions (pH, temperature, cofactors)

    • Use of genomic DNA versus edited cDNA, considering the importance of RNA editing

  • Environmental factors:

    • Growing conditions affect plant metabolism and potentially ndhA function

    • Stress exposure history may alter regulatory networks

  • Tissue-specific considerations:

    • ndhA may have different roles in different tissues

    • Expression levels and RNA editing efficiency may vary by tissue

  • Interaction networks:

    • A. calamus extracts interact with cytochrome P450 enzymes , suggesting complex metabolic networks

    • Different experimental contexts may include varying interacting partners

To resolve contradictions, researchers should:

  • Design experiments that specifically test competing hypotheses

  • Standardize methodologies across laboratories

  • Ensure comprehensive reporting of genotype information, growth conditions, and experimental protocols

  • Consider meta-analysis approaches to identify patterns explaining apparent contradictions

What emerging technologies offer new opportunities for studying Acorus calamus ndhA?

Several cutting-edge technologies present promising avenues for advancing Acorus calamus ndhA research:

  • CRISPR-Cas9 genome editing:

    • Create precise modifications to study structure-function relationships

    • Develop knockout lines to assess physiological importance

    • Engineer variants to test hypotheses about RNA editing sites

  • Single-cell transcriptomics:

    • Reveal cell-type specific expression patterns

    • Identify regulatory networks at cellular resolution

    • Detect rare cell populations with specialized ndhA functions

  • Cryo-electron microscopy:

    • Determine high-resolution structure of ndhA in its native complex

    • Visualize conformational changes during electron transport

    • Compare structures from different genotypes

  • Nanopore direct RNA sequencing:

    • Directly detect RNA modifications without amplification bias

    • Identify novel editing sites in real-time

    • Quantify editing efficiency more accurately

  • Metabolic flux analysis using stable isotopes:

    • Trace carbon flow through pathways connected to ndhA function

    • Link chloroplast electron transport to specialized metabolite production

    • Identify bottlenecks where ndhA activity influences medicinal compound synthesis

These technologies, applied to the diverse genotypes of A. calamus with their varying levels of bioactive compounds , could significantly advance our understanding of how chloroplast function relates to medicinal properties.

How might understanding ndhA function contribute to broader research on medicinal plants?

Research on Acorus calamus ndhA has potential to advance multiple aspects of medicinal plant science:

  • Linking primary and specialized metabolism:

    • Clarify how chloroplast electron transport influences production of medicinal compounds

    • Identify regulatory nodes where photosynthetic function affects therapeutic properties

    • Develop models predicting medicinal efficacy based on chloroplast gene expression

  • Understanding adaptation mechanisms:

    • Reveal how ndhA variants contribute to A. calamus adaptation across diverse habitats

    • Connect genetic diversity (24.71% polymorphism) to functional diversity

    • Identify selection pressures driving evolution of medicinal properties

  • Improving cultivation practices:

    • Develop conditions optimizing ndhA function for enhanced medicinal compound production

    • Select genotypes with optimal ndhA variants for specific therapeutic applications

    • Engineer growth environments to modulate RNA editing efficiency

  • Advancing ethnopharmacological validation:

    • Provide molecular mechanisms underlying traditional uses

    • Connect A. calamus traditional applications in voice disorders to molecular function

    • Validate relationships between ndhA activity and documented neuroprotective effects

  • Enhancing biotechnological applications:

    • Identify genotypes with low β-asarone content (associated with toxicity concerns) for commercial development

    • Engineer expression systems producing therapeutic compounds linked to ndhA function

    • Develop molecular markers for selecting superior medicinal genotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.