Recombinant Acorus calamus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLLISSVIPILAFLISGVLAPTREGPEKLSSYESGIEPIGDAWVQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFLEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers, subsequently transferring them to quinones within the photosynthetic and potentially the chloroplast respiratory chains. In this species, plastoquinone is believed to be the immediate electron acceptor. This process couples the redox reaction with proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of NAD(P)H-quinone oxidoreductase subunit 3 in Acorus calamus chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a crucial component of the chloroplastic NDH complex in Acorus calamus, participating in cyclic electron flow around photosystem I and chlororespiration. The protein plays a vital role in energy balance and photoprotection mechanisms, particularly under stress conditions. In Acorus calamus, which has been extensively studied for its medicinal properties, the chloroplastic electron transport components like ndhC may contribute to the plant's ability to produce bioactive compounds under varying environmental conditions .

How does recombinant expression affect the structural integrity of ndhC protein?

When expressing recombinant ndhC protein, several factors can impact structural integrity. The protein's native conformation depends on proper folding, which can be affected during heterologous expression. Research indicates that when expressed in E. coli, chloroplastic proteins like ndhC may require specific conditions to maintain their structure.

Based on similar recombinant protein studies, the following factors are critical for structural integrity:

FactorImpact on Structural IntegrityOptimization Strategy
Expression temperatureLower temperatures (15-25°C) typically improve foldingUse factorial design to determine optimal temperature
Induction timingMid-exponential phase induction often yields better resultsInduce at OD600 of 0.6-0.8
Buffer compositionPhosphate buffers with stabilizing agents maintain structureInclude glycerol and reducing agents
Purification methodAffinity tags may affect tertiary structureConsider tag-removal steps

Circular dichroism spectroscopy and thermal shift assays are recommended to verify structural integrity after purification .

What experimental design approach is most effective for optimizing recombinant ndhC expression?

A multivariant factorial design approach is strongly recommended for optimizing recombinant ndhC expression. This method is superior to traditional univariant approaches as it allows for the evaluation of multiple variables simultaneously while accounting for their interactions.

For ndhC expression, a fractional factorial design (2^8-4) with the following variables has proven effective:

  • Induction temperature (15°C vs. 25°C)

  • IPTG concentration (0.1 mM vs. 1.0 mM)

  • Cell density at induction (OD600 0.6 vs. 1.0)

  • Post-induction time (4 h vs. 16 h)

  • Media composition (standard LB vs. enriched)

  • Aeration rate

  • pH of medium

  • Presence of chaperone co-expression

This approach allows researchers to identify the most significant variables affecting expression and their interactions, gathering high-quality information with fewer experiments. Statistical analysis should evaluate cell growth, protein yield, and biological activity as response variables .

The induction timing is particularly critical, as research indicates that for chloroplastic proteins, induction in the middle of the exponential growth phase typically yields better results than early or late induction .

How should control experiments be designed when studying recombinant ndhC activity?

When studying recombinant ndhC activity, properly designed control experiments are essential for valid interpretation of results. A comprehensive control strategy should include:

Negative Controls:

  • Empty vector expression without ndhC gene

  • Heat-inactivated ndhC protein

  • Reaction mixture without electron donor/acceptor

Positive Controls:

  • Commercial NDH complex (if available)

  • Well-characterized recombinant protein from the same family

Process Controls:

  • Wild-type ndhC protein (if available)

  • Same protein batch stored under different conditions to assess stability

Consider implementing a randomized block design to minimize the effects of experimental variables and batch-to-batch variations. This is particularly important when comparing activity across different experimental conditions .

What purification strategy yields the highest purity and activity for recombinant ndhC?

Based on data from related chloroplastic proteins, a multi-step purification strategy is recommended for recombinant ndhC:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using the His-tag present on most recombinant ndhC constructs. Optimal conditions include:

    • Buffer: 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10% glycerol

    • Imidazole gradient: 20-250 mM

    • Flow rate: 1 ml/min

  • Intermediate Purification: Ion exchange chromatography to separate charged variants

    • Buffer: 20 mM Tris-HCl, pH 7.5, 50-500 mM NaCl gradient

  • Polishing Step: Size exclusion chromatography to ensure homogeneity

    • Buffer: 20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5% glycerol

This approach typically achieves >90% purity as determined by SDS-PAGE, while maintaining functional activity .

For storage, lyophilization in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended. Avoid repeated freeze-thaw cycles, and store working aliquots at 4°C for up to one week .

What analytical methods are most appropriate for confirming the identity and functionality of purified ndhC?

A comprehensive analytical approach is essential for confirming both identity and functionality of purified recombinant ndhC:

Identity Confirmation:

  • Western blotting with anti-His tag antibodies and, if available, specific anti-ndhC antibodies

  • Peptide mass fingerprinting via mass spectrometry after tryptic digestion

  • N-terminal sequencing to confirm proper processing

Structural Analysis:

  • Circular dichroism spectroscopy to assess secondary structure

  • Thermal shift assays to evaluate stability

  • Dynamic light scattering to check for aggregation

Functional Assessment:

  • NAD(P)H oxidation assay monitoring absorbance decrease at 340 nm

  • Electron transfer activity using artificial electron acceptors (e.g., ferricyanide)

  • ROS production measurement using fluorescent probes

The combination of these methods provides comprehensive characterization and ensures both structural and functional integrity of the purified protein .

How can recombinant ndhC be utilized to study electron transport mechanisms in stress conditions?

Recombinant ndhC offers a powerful tool for studying electron transport under various stress conditions. A systematic approach includes:

  • In vitro reconstitution studies:

    • Combine purified recombinant ndhC with other NDH complex components to reconstruct partial or complete complexes

    • Measure electron transfer rates under varying pH, temperature, and salt concentrations to mimic stress conditions

  • ROS generation analysis:

    • Compare electron leakage and superoxide production under normal vs. stress conditions

    • Correlate with data from Acorus calamus plants under similar stresses

  • Inhibitor studies:

    • Use specific inhibitors to block different steps of electron transport

    • Determine rate-limiting steps under stress conditions

  • Site-directed mutagenesis:

    • Create variants of ndhC with mutations at key residues

    • Assess impact on electron transport efficiency and stress response

This approach allows researchers to connect the molecular function of ndhC to whole-plant stress responses, particularly relevant given the known antioxidant properties of Acorus calamus extracts .

What methodological approaches can resolve contradictory data when studying ndhC interactions with other proteins?

When faced with contradictory data regarding ndhC protein interactions, a multi-method verification approach is essential:

  • Complementary binding assays:

    • Use multiple techniques with different principles (e.g., co-immunoprecipitation, pull-down assays, and surface plasmon resonance)

    • Compare binding under varying conditions to identify context-dependent interactions

  • Cross-validation with in vivo studies:

    • Compare in vitro binding data with co-localization studies in chloroplasts

    • Implement BiFC (Bimolecular Fluorescence Complementation) to verify interactions in plant cells

  • Computational modeling:

    • Perform molecular docking simulations to predict interaction interfaces

    • Use these predictions to design mutations that specifically disrupt predicted interactions

  • Statistical meta-analysis:

    • Apply bootstrapping procedures or non-parametric statistical methods to evaluate the robustness of contradictory results

    • Identify experimental variables that might explain discrepancies

For complex formation analysis, blue native PAGE followed by western blotting can help determine if ndhC forms stable complexes with partner proteins or exists in multiple assembly states .

What statistical approaches are most appropriate for analyzing variations in ndhC activity across different experimental conditions?

The statistical analysis of ndhC activity data requires careful consideration of experimental design and data characteristics:

  • For factorial designs:

    • Analysis of Variance (ANOVA) to identify significant main effects and interactions

    • Include post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

    • Consider robust non-parametric methods such as bootstrapping procedures when assumptions of normality are violated

  • For dose-response experiments:

    • Non-linear regression to determine EC50 or IC50 values

    • Compare curve parameters across different conditions using extra sum-of-squares F test

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Consider autocorrelation structures for closely spaced time points

  • Data visualization:

    • Heat maps for visualization of multiple parameter effects

    • Interaction plots to display combined effects of multiple variables

A minimum sample size of n=5 is recommended for each experimental condition, though n=7 provides better power even if a few samples are lost during quality control .

How can researchers integrate ndhC functional data with broader Acorus calamus metabolic studies?

Integrating ndhC functional data with broader metabolic studies requires a systems biology approach:

  • Correlation analysis:

    • Calculate Pearson or Spearman correlations between ndhC activity metrics and metabolite levels

    • Use hierarchical clustering to identify patterns across multiple conditions

  • Pathway analysis:

    • Map ndhC function to chloroplast electron transport and connect to downstream metabolic pathways

    • Consider how ndhC function might influence the production of bioactive compounds in Acorus calamus, such as α and β-asarone

  • Multi-omics integration:

    • Combine proteomics data on ndhC expression/modification with metabolomics data

    • Use principal component analysis or partial least squares regression to identify relationships

  • Contextual interpretation:

    • Interpret ndhC function in light of known medicinal properties of Acorus calamus

    • Consider how electron transport efficiency might impact the plant's ability to synthesize compounds with antioxidant, antidepressant, or neuroprotective effects

This integrated approach can help elucidate how fundamental chloroplast functions connect to the therapeutic properties that have made Acorus calamus valuable in traditional medicine systems .

How might CRISPR-Cas9 editing be used to study ndhC function in Acorus calamus?

CRISPR-Cas9 technology offers powerful approaches for studying ndhC function in Acorus calamus:

  • Gene knockout studies:

    • Design guide RNAs targeting conserved regions of ndhC

    • Create knockout lines to assess phenotypic effects under normal and stress conditions

    • Compare photosynthetic efficiency and ROS production in wild-type vs. knockout plants

  • Domain-specific mutations:

    • Utilize homology-directed repair to introduce specific mutations in functional domains

    • Create plants with altered ndhC activity rather than complete loss-of-function

  • Promoter modifications:

    • Edit regulatory regions to create plants with altered ndhC expression patterns

    • Study the effect of ndhC overexpression on stress tolerance and secondary metabolite production

  • Tagged variants:

    • Insert fluorescent protein tags for in vivo localization and interaction studies

    • Create plants expressing affinity-tagged ndhC for in vivo pull-down experiments

These genetic approaches can complement in vitro studies with recombinant protein and provide systems-level insights into ndhC function in the context of whole-plant physiology and metabolism .

What are the considerations for using recombinant ndhC in structural biology studies?

Structural biology studies of recombinant ndhC require careful planning:

  • Expression systems for structural studies:

    • Consider insect cell expression for complex membrane proteins

    • Evaluate prokaryotic systems with enhanced membrane protein folding capabilities

    • Typical yields of 250 mg/L of soluble protein are possible with optimized E. coli expression

  • Purification for structural integrity:

    • Use mild detergents for membrane protein extraction

    • Consider amphipols or nanodiscs for maintaining native-like environment

    • Implement stringent monodispersity screening by dynamic light scattering

  • Crystallization approaches:

    • Lipidic cubic phase crystallization for membrane proteins

    • Screening with and without binding partners

    • Consider antibody fragment co-crystallization to stabilize flexible regions

  • Complementary methods:

    • Cryo-electron microscopy for structure determination without crystallization

    • Small-angle X-ray scattering for solution structure

    • Nuclear magnetic resonance for dynamic studies of specific domains

  • Structure validation:

    • Functional assays to confirm that structural studies haven't compromised activity

    • Compare with homology models based on related proteins

    • Validate key structural features through mutagenesis and functional testing

These approaches can provide valuable insights into the molecular mechanism of ndhC function and its interactions within the larger NDH complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.