Recombinant Acorus calamus NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

What is the basic structure and function of Recombinant Acorus calamus NAD(P)H-quinone oxidoreductase subunit 4L?

Recombinant Acorus calamus NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a chloroplast-encoded protein component of the NAD(P)H dehydrogenase complex. The protein consists of 101 amino acids with the sequence: MmLEYVLFLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSIRINQSNLLNK . It functions as part of the electron transport chain in chloroplasts, facilitating electron transfer from NAD(P)H to quinones. This enzyme plays a critical role in cyclic electron flow around photosystem I and contributes to ATP production during photosynthesis under various stress conditions .

What is the taxonomic source of this protein?

The protein is derived from Acorus calamus, commonly known as Sweet flag, a semi-aquatic, perennial monocotyledonous plant. Acorus calamus has been extensively used in traditional medicine across various cultures, particularly in India, for treating neurological, metabolic, and respiratory disorders . The species belongs to the family Acoraceae and represents one of the earliest diverging lineages of monocots, making it particularly interesting for evolutionary studies of chloroplast proteins .

What are the recommended storage conditions for the recombinant protein?

The recombinant protein should be stored at -20°C for regular use, while -80°C is recommended for extended storage. The shelf life is approximately 6 months for liquid formulations and 12 months for lyophilized forms when stored at these temperatures . For working solutions, it is advisable to store aliquots at 4°C for no more than one week, as repeated freezing and thawing significantly reduces protein stability and activity . Standard storage buffers include Tris-based solutions with 50% glycerol, which help maintain protein integrity during freeze-thaw cycles .

What identification and tracking systems are available for this protein?

The protein can be identified and tracked using several database references including:

• UniProt accession number: Q3V4Y2

• Enzyme Commission (EC) number: 1.6.5.-

• Gene name: ndhE

• Commercial product codes: CSB-EP664995ACE1 (CUSABIO)

These identifiers facilitate consistent referencing in research publications and database searches .

What is the role of ndhE in plant stress responses and adaptation mechanisms?

The NDH complex containing ndhE plays a crucial role in cyclic electron transport around photosystem I, which becomes particularly important under environmental stress conditions. Research into related quinone oxidoreductases indicates their involvement in protecting against oxidative stress by maintaining redox balance in chloroplasts .

Studies with Acorus calamus extracts demonstrate significant antioxidant properties, suggesting that proteins like ndhE may contribute to the plant's remarkable resilience against environmental stressors . Under stress conditions, the NDH complex helps maintain ATP production when linear electron flow is impaired, thus contributing to energy homeostasis in the chloroplast. Additionally, by regulating the redox state of the plastoquinone pool, the NDH complex may influence retrograde signaling from the chloroplast to the nucleus, affecting nuclear gene expression patterns in response to environmental changes .

What experimental approaches are most effective for studying the in vivo activity of ndhE in chloroplasts?

Studying the in vivo activity of ndhE requires a multi-faceted approach:

• Chlorophyll fluorescence analysis: Measuring parameters such as NPQ (non-photochemical quenching) and transient chlorophyll fluorescence can provide insights into NDH complex activity.

• Genetic manipulation: Creating knockout or knockdown lines for ndhE followed by phenotypic analysis under various stress conditions.

• Proteomic approaches: Blue-native PAGE combined with mass spectrometry to analyze intact NDH complexes and their subunit composition.

• Biophysical techniques: Electron paramagnetic resonance (EPR) spectroscopy to track electron transfer within the NDH complex.

• Electrochromic shift measurements: To assess proton gradient formation across the thylakoid membrane, which is influenced by NDH activity.

These approaches allow researchers to connect biochemical activities observed in vitro with physiological functions in the intact chloroplast .

How does the recombinant ndhE interact with other components of the NDH complex?

The ndhE subunit forms part of the membrane domain of the NDH complex, interacting with other membrane-embedded subunits to form a functional electron transport apparatus. Protein-protein interaction studies using techniques such as yeast two-hybrid, co-immunoprecipitation, or crosslinking approaches have shown that ndhE interacts primarily with other NDH membrane subunits like ndhC, ndhD, and ndhG .

These interactions are critical for the assembly and stability of the complete NDH complex. The hydrophobic nature of ndhE (as evidenced by its amino acid sequence) facilitates its integration into the membrane domain, where it contributes to the formation of the proton translocation pathway. Understanding these interactions is essential for reconstructing the complete structure and function of the chloroplast NDH complex .

What is the optimal protocol for expression and purification of recombinant ndhE protein?

The optimal protocol for expression and purification of recombinant ndhE involves:

Expression System:

• E. coli is the preferred expression system for recombinant ndhE production

• BL21(DE3) or similar strains optimized for membrane protein expression

• Temperature optimization: Induction at lower temperatures (16-18°C) improves proper folding

• IPTG concentration: 0.1-0.5 mM for controlled induction

Purification Strategy:

• Cell lysis under native conditions using mild detergents (0.5-1% n-dodecyl β-D-maltoside)

• Initial purification via affinity chromatography (His-tag or other fusion tags)

• Secondary purification through ion exchange chromatography

• Final polishing step using size exclusion chromatography

• Buffer optimization containing stabilizing agents like glycerol (5-50%)

This approach typically yields recombinant protein with >85% purity as determined by SDS-PAGE, suitable for functional and structural studies .

What analytical techniques are most effective for assessing the functional activity of recombinant ndhE?

Multiple analytical approaches can be employed to assess the functional activity of recombinant ndhE:

Spectrophotometric Assays:

• NADPH oxidation monitoring at 340 nm

• Artificial electron acceptor reduction (such as ferricyanide or dichlorophenolindophenol)

• Oxygen consumption measurements for comprehensive activity assessment

Advanced Biophysical Techniques:

• Isothermal titration calorimetry (ITC) to determine binding parameters with cofactors

• Surface plasmon resonance (SPR) to study protein-protein interactions with other NDH subunits

• Circular dichroism (CD) to confirm proper protein folding and secondary structure

Enzymatic Analysis Parameters:

• pH optima determination (typically pH 7.0-7.5)

• Temperature stability profiling

• Kinetic parameter determination (Km, Vmax, kcat)

• Cofactor requirement analysis

These techniques enable comprehensive characterization of the recombinant protein's functional properties and can reveal insights into its role within the larger NDH complex .

How can researchers overcome challenges in maintaining stability of recombinant ndhE during experimental procedures?

Maintaining stability of recombinant ndhE presents several challenges due to its membrane protein nature. Researchers can employ the following strategies:

Buffer Optimization:

• Include 5-50% glycerol in storage buffers

• Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

• Maintain physiological pH (7.0-7.5)

• Include mild detergents at concentrations just above critical micelle concentration

Storage Recommendations:

• Store concentrated stock solutions (0.1-1.0 mg/mL)

• Prepare small working aliquots to avoid repeated freeze-thaw cycles

• For short-term storage (≤1 week), maintain at 4°C

• For long-term storage, store at -20°C or preferably -80°C

Stability Enhancers:

• Consider addition of specific lipids (DGDG, MGDG) to mimic native environment

• Add crowding agents like PEG or sucrose

• Include specific cofactors that promote proper folding

These approaches significantly extend the functional lifetime of the recombinant protein, allowing for more reliable experimental outcomes .

What considerations are important for designing experiments that compare wild-type and mutant variants of ndhE?

When designing comparative experiments between wild-type and mutant ndhE variants, researchers should consider:

Mutation Strategy:

• Target conserved residues identified through multiple sequence alignments

• Focus on hydrophobic regions involved in membrane anchoring

• Consider residues predicted to interact with other NDH subunits

• Create systematic alanine-scanning libraries for comprehensive functional mapping

Expression Control:

• Use identical expression vectors and conditions

• Verify equivalent expression levels through western blotting

• Ensure comparable solubility profiles

• Normalize protein concentrations accurately for direct comparisons

Functional Assays:

• Employ multiple complementary activity assays

• Include positive and negative controls in each experiment

• Perform experiments at various substrate concentrations

• Analyze kinetic parameters rather than single-point measurements

Structural Verification:

• Confirm proper folding through CD spectroscopy

• Verify membrane integration properties

• Assess complex formation capabilities with other NDH subunits

These considerations ensure that observed differences can be confidently attributed to the specific mutations rather than experimental variables .

How might ndhE research contribute to understanding the medicinal properties of Acorus calamus?

The investigation of ndhE and related proteins may offer valuable insights into the medicinal properties of Acorus calamus. Research indicates that Acorus calamus exhibits significant antioxidant, antidepressant, and neuroprotective effects, which may be linked to the plant's unique metabolic pathways and stress responses . The NDH complex, including ndhE, plays a crucial role in maintaining cellular redox balance, particularly under stress conditions.

Studies have demonstrated that Acorus calamus extracts significantly enhance antioxidant capacity in rat models subjected to social isolation stress, suggesting an interconnection between the plant's stress resistance mechanisms and its therapeutic effects . Since ndhE contributes to electron transport and energy production in chloroplasts under stress, understanding its function could reveal how Acorus calamus generates bioactive compounds with medicinal properties under various environmental conditions .

What role might ndhE play in the adaptation of Acorus calamus to different environmental conditions?

The ndhE protein, as part of the chloroplast NDH complex, likely plays a significant role in adapting Acorus calamus to various environmental stresses. The NDH complex becomes particularly important under conditions that impair linear electron flow in photosynthesis, such as low light, temperature extremes, or drought.

Acorus calamus demonstrates remarkable adaptability to diverse habitats, from marshy wetlands to drier environments. This adaptability may be partially attributed to efficient cyclic electron flow mechanisms that involve the NDH complex . By maintaining ATP production under suboptimal conditions, ndhE and the NDH complex could contribute to the plant's stress tolerance and ecological flexibility.

Furthermore, the antioxidant properties exhibited by Acorus calamus in experimental models suggest that its electron transport systems, including those involving ndhE, may efficiently manage reactive oxygen species production during stress, contributing to the plant's resilience .

What comparative insights might be gained from studying ndhE across different species within the Acoraceae family?

Comparative analysis of ndhE across Acoraceae species would provide valuable evolutionary insights:

Evolutionary Conservation Analysis:

• Sequence conservation patterns could reveal functionally critical regions

• Identification of species-specific adaptations in the protein structure

• Assessment of selection pressures on different domains

Structure-Function Relationships:

• Correlation between sequence variations and habitat-specific adaptations

• Identification of conserved interaction sites with other NDH subunits

• Emergence of species-specific regulatory mechanisms

Taxonomic Applications:

• Development of molecular markers for Acoraceae classification

• Resolution of phylogenetic relationships within the family

• Identification of unique signatures for authentication of medicinal Acorus species

This comparative approach would significantly enhance our understanding of how ndhE has evolved within this ancient plant lineage and could potentially reveal specialized adaptations related to the medicinal properties of different Acorus species .

What are the key considerations for researchers beginning work with Recombinant Acorus calamus ndhE?

Researchers initiating studies with recombinant Acorus calamus ndhE should consider several critical factors to ensure successful outcomes:

Technical Considerations:

• Optimal expression systems (E. coli BL21 strains recommended)

• Purification strategies that preserve native structure

• Storage conditions (-20°C/-80°C with 50% glycerol recommended)

• Activity assay selection based on research objectives

Experimental Design:

• Include appropriate positive and negative controls

• Design experiments that account for the membrane protein nature of ndhE

• Consider the influence of detergents on protein function

• Implement complementary analytical approaches

Interpretation Challenges:

• Differentiate between direct effects of ndhE and indirect consequences

• Account for interactions with other NDH subunits

• Correlate in vitro findings with in vivo functions

• Consider evolutionary context when interpreting results

By addressing these considerations, researchers can develop robust experimental approaches that yield reliable and meaningful data about this important chloroplastic protein .

How can interdisciplinary approaches enhance our understanding of ndhE function and applications?

Interdisciplinary research approaches can significantly advance our understanding of ndhE:

Integrative Methodologies:

• Combining structural biology with functional biochemistry

• Merging molecular biology with medicinal chemistry

• Integrating biophysical analyses with physiological studies

• Applying bioinformatics to interpret experimental data

Cross-disciplinary Applications:

• Pharmaceutical research exploring Acorus calamus bioactives

• Agricultural research on stress tolerance mechanisms

• Evolutionary biology studies on chloroplast protein evolution

• Biotechnology applications in photosynthesis engineering

Collaborative Frameworks:

• Partnerships between plant biochemists and medicinal chemists

• Cooperation between structural biologists and biophysicists

• Integration of traditional knowledge with modern scientific approaches