Recombinant Acorus calamus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Expression Conditions

The expression conditions typically involve:

  • Expression host: E. coli expression systems

  • Vector selection: Vectors compatible with membrane protein expression

  • Induction parameters: Optimized for membrane protein production

  • Extraction methods: Specialized extraction due to the hydrophobic nature of the protein

Purification Protocol

The recombinant protein is typically available as:

  • Physical form: Lyophilized powder

  • Storage buffer: Tris-based buffer with 50% glycerol, pH optimized for protein stability

  • Storage conditions: -20°C for short-term storage and -80°C for extended storage

Recommendations for handling include avoiding repeated freeze-thaw cycles and storing working aliquots at 4°C for up to one week . Proper reconstitution involves centrifugation prior to opening the vial and reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

Functional Properties and Biological Role

The ndhG protein serves as an integral component of the NAD(P)H dehydrogenase complex in chloroplasts. This complex plays crucial roles in:

  1. Cyclic electron transport around photosystem I

  2. Chlororespiration

  3. Plant response to various environmental stresses

  4. Optimization of photosynthetic efficiency under changing light conditions

The protein functions as part of a multiprotein complex that catalyzes the transfer of electrons from NAD(P)H to plastoquinone, an important step in alternative electron transport pathways in chloroplasts. The official enzyme classification (EC 1.6.5.-) reflects its oxidoreductase activity, specifically acting on NAD(P)H with quinones or similar compounds as acceptors .

The ndhG gene resides in the chloroplast genome of Acorus calamus. Analysis of chloroplast DNA sequences provides valuable insights into the genetic characteristics of this species. DNA extraction from Acorus samples typically employs specialized plant extraction kits to ensure high-quality genomic material .

The chloroplast genes including ndhG show high homology between different Acorus species. For instance, analysis of the rbcL region of chloroplast DNA revealed that sequences from A. gramineus, A. calamus, and A. tatarinowii share approximately 99% homology, with only a 1 bp variation . This high level of conservation indicates the evolutionary importance of chloroplast genes in these related species.

DNA amplification methods such as PCR using specific primers designed for chloroplast genes allow for the selective amplification and subsequent analysis of these genetic regions. The design of internal primers common to multiple Acorus species demonstrates the conserved nature of these chloroplast genes .

Applications in Research and Biotechnology

Recombinant Acorus calamus ndhG protein has several potential applications in research and biotechnology:

Biochemical Investigations

The protein serves as a valuable tool for:

  • In vitro enzyme activity assays

  • Electron transport studies

  • Investigation of inhibitor interactions

Biotechnological Applications

Potential applications include:

  • Development of biosensors for detecting electron transport inhibitors

  • Engineering of plants with modified photosynthetic efficiency

  • Production of antibodies for immunological detection methods

Relationship to Medicinal Properties of Acorus calamus

The plant contains various bioactive molecules that can mitigate oxidative stress through multiple signaling pathways. These compounds may influence mitochondrial and chloroplast function, potentially involving proteins like ndhG in their mechanisms of action . Further research is needed to establish any specific role of ndhG in the medicinal properties of Acorus calamus.

Future Research Directions

Several promising research avenues for Acorus calamus ndhG protein include:

  1. Detailed structural analysis using advanced techniques such as cryo-electron microscopy

  2. Investigation of post-translational modifications and their impact on protein function

  3. Comparative genomics and proteomics across different Acorus species

  4. Exploration of potential interactions with pharmaceutical compounds derived from Acorus calamus

  5. Development of improved expression systems for higher yield and purity

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDVLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSYFVAA AQLLIYVGAVNVLIIFAVMFMNGSDYSNDFYLWTVGDGVTSLVCTSILFSLITTILDTSW YGIIWNTGSNQIVEQDLTSNVQQIGIHLSTDFYLPFELVSIILLVALIGAITMARQY
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. This process couples the redox reaction to proton translocation, conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ndhG in the NDH complex of Acorus calamus?

The ndhG subunit serves as one of the primary proton pumps within the chloroplast NAD(P)H dehydrogenase (NDH) complex located in the thylakoid membranes. This complex mediates cyclic electron transport around Photosystem I (PSI), redirecting electrons from ferredoxin to the plastoquinone pool while simultaneously pumping protons from the stroma into the lumen . The ndhG subunit is encoded in the chloroplast genome and is part of the membrane-embedded apparatus that facilitates this proton translocation, which ultimately contributes to ATP synthesis without accumulating NADPH .

In Acorus calamus specifically, the NDH complex likely plays a similar role as in other plants, contributing to medicinal properties through its involvement in the plant's stress response mechanisms . The complex's ability to maintain redox balance may be particularly important in wetland environments where A. calamus naturally grows.

How does the structure of ndhG relate to its function within the NDH-PSI supercomplex?

The ndhG protein is integrated into subcomplex A (SubA) of the NDH complex. Based on structural studies of similar complexes, ndhG spans the thylakoid membrane with multiple transmembrane domains that form part of the proton translocation pathway . The NDH complex in chloroplasts consists of several subcomplexes including SubA (containing chloroplast-encoded subunits including ndhG), SubB, SubL (lumen subcomplex), SubM (membrane subcomplex), and SubE (electron donor-binding subcomplex) .

This organization into a supercomplex with PSI enhances stability under stress conditions, particularly strong light. The arrangement minimizes the distance for electron transfer, which is critical for rapid cycling of electrons that helps protect against oxidative damage . Specific amino acid residues in ndhG, particularly at position 7 (where substitutions between Ile and Lys have been documented), can significantly impact the activity of the entire complex .

What evidence exists for genetic variation in ndhG across Acorus species?

While specific data for all Acorus species is limited in the search results, research has documented three main species: Acorus americanus (native to the US), Acorus calamus (Europe), and Acorus gramineus (Asia) . Genetic variation in ndhG has been observed between different plant accessions, with significant functional consequences.

For example, in Arabidopsis, a single amino acid substitution (Ile7 to Lys7) in ndhG resulted in measurable differences in NDH activity and recovery of quantum yield of Photosystem II (ΦPSII) following illumination . Similar variations likely exist across Acorus species given their distinct geographical origins and evolutionary histories, potentially contributing to their adaptation to different environments.

What are the most effective methods for measuring ndhG-dependent NDH activity?

The post-illumination chlorophyll fluorescence rise is the gold standard for measuring NDH activity. This methodology can be implemented through:

  • High-throughput chlorophyll fluorescence imaging: Measures the characteristic rise in chlorophyll fluorescence after turning off actinic light, which directly correlates with NDH activity .

  • Comparative analysis with knockout mutants: Including known NDH-deficient mutants (such as ndho and ndhm) as controls to validate the specificity of the measurement .

  • Nucleotype-plasmotype combinations: Using cybrids (plants with different combinations of nuclear and chloroplast genomes) to isolate the effects of ndhG variations from other genetic factors .

The measurement protocol typically involves:

  • Dark adaptation of leaf samples

  • Application of saturating light pulse

  • Actinic light exposure period

  • Light removal with continued fluorescence monitoring

  • Quantification of the post-illumination fluorescence rise

ParameterCol-0 (control)ndho mutantndhm mutantAcorus calamus extract
Post-illumination fluorescence risePresentAbsentAbsentVariable (genotype-dependent)
Relative NDH activity100%<5%<5%40-80% (estimated)

What expression systems are most suitable for producing recombinant Acorus calamus ndhG?

Production of functional recombinant ndhG presents unique challenges due to its:

  • Chloroplast origin and membrane-integrated nature

  • Requirements for proper folding and integration into the NDH complex

  • Possible post-translational modifications

Recommended expression systems include:

  • Chloroplast transformation in model plants: Direct transformation of tobacco or Chlamydomonas reinhardtii chloroplasts with the A. calamus ndhG gene provides the most native-like environment for proper folding and integration.

  • Bacterial expression with membrane-targeting sequences: Using specialized E. coli strains (C41/C43) with membrane-targeting sequences and careful solubilization protocols.

  • Cell-free expression systems: For initial structural and functional studies, particularly when combined with nanodiscs or liposomes to provide a lipid environment.

The methodology should include verification of proper folding through activity assays measuring electron transfer capabilities and proton translocation efficiency.

How can researchers effectively design experiments to study ndhG allelic variants?

Based on research approaches documented in the search results , an effective experimental design should include:

  • Genetic exclusion approach: Using accessions that differ in candidate SNPs to narrow down causal genetic variations.

  • Full diallel design: Creating reciprocal hybrids that differ only in their plasmotype to determine whether a given plasmotype conveys altered phenotypes.

  • Cybrid creation: Generating plants with different combinations of nuclear and chloroplast genomes to isolate the effects of ndhG variants from nuclear genetic effects.

  • Site-directed mutagenesis: For targeted modification of specific amino acids (e.g., position 7) to verify their functional significance.

  • Phenotypic characterization: Measuring NDH activity through post-illumination fluorescence rise and recovery of ΦPSII under various light conditions and stresses.

This approach has successfully identified the Ile7 to Lys7 substitution in ndhG as causal to differences in NDH activity and recovery of ΦPSII .

How does ndhG-dependent cyclic electron transport contribute to plant stress responses?

The NDH complex, including ndhG, plays critical roles in multiple stress responses:

  • Temperature stress: NDH-deficient mutants accumulate reactive oxygen species more readily under both low (4°C) and high (42°C) temperature conditions . The ndhG-containing NDH complex helps maintain photosynthetic efficiency under these conditions.

  • Oxidative stress: NDH-mediated CET alleviates oxidative stress under fluctuating light conditions by maintaining redox balance and preventing over-reduction of the electron transport chain .

  • Drought adaptation: NDH activity increases under water limitation, potentially providing additional ATP required for osmotic adjustment and repair processes .

  • Nutrient deficiency: Enhanced NDH activity has been observed under phosphorus deficiency, suggesting a role in adapting to nutrient-limited conditions .

The mechanism involves:

  • Accelerated electron consumption limiting ferredoxin over-reduction

  • Enhanced proton gradient generation providing additional ATP

  • Stabilization of PSI under stress conditions

  • Reduction of reactive oxygen species accumulation

These protective functions make ndhG and the NDH complex promising targets for improving crop resilience to environmental stresses.

What are the metabolic consequences of ndhG variation on photosynthetic efficiency?

Variations in ndhG directly impact:

  • ATP/NADPH ratio: Different ndhG alleles alter NDH activity, affecting cyclic electron flow and consequently the ATP/NADPH ratio produced during photosynthesis .

  • Recovery from photoinhibition: Plants with the Bur-0 plasmotype (containing a variant ndhG allele) showed faster recovery of ΦPSII than those with the Col-0 plasmotype, indicating altered regulation of electron transport .

  • Carbon assimilation under fluctuating conditions: Enhanced NDH activity can improve carbon fixation efficiency, particularly under rapidly changing light conditions or when carbon demands suddenly increase .

ndhG variantRelative NDH activityΦPSII recovery rateATP/NADPH ratio adjustment
Col-0 typeHigherSlowerMore flexible
Bur-0 typeLowerFasterLess flexible

How might ndhG engineering contribute to improving photosynthetic efficiency in crops?

Engineering ndhG could enhance crop productivity through several mechanisms:

Research approaches should include targeted mutagenesis followed by comprehensive phenotyping under various environmental conditions, including measurement of photosynthetic parameters, growth, and yield components.

What are the major challenges in isolating and characterizing the NDH complex containing ndhG?

Researchers face several challenges when working with the NDH complex:

  • Low abundance: The NDH complex is present at much lower levels than other photosynthetic complexes, making isolation difficult without significant cross-contamination .

  • Membrane integration: As an integral membrane protein complex, extraction requires careful optimization of detergent types and concentrations to maintain native structure and function.

  • Complex assembly dependencies: The NDH complex consists of multiple subcomplexes with intricate assembly pathways. Disruption of one subunit (like ndhG) can affect the stability and assembly of the entire complex .

  • Functional redundancy: The presence of multiple cyclic electron transport pathways (NDH-dependent and PGR5/PGRL1-dependent) means that phenotypes of single pathway modifications may be masked by compensation from the other pathway .

Recommended approaches include:

  • Gentle solubilization using mild detergents like digitonin

  • Blue-native PAGE for separation of intact complexes

  • Affinity tagging of specific subunits for pull-down assays

  • Cryoelectron microscopy for structural analysis

How can researchers differentiate between NDH-mediated and PGR5/PGRL1-mediated cyclic electron transport?

To distinguish between these two CET pathways, researchers should employ:

  • Inhibitor studies: The PGR5/PGRL1 pathway is sensitive to antimycin A, while the NDH pathway is not. Differential responses to antimycin A treatment can help separate the contributions of each pathway .

  • Genetic approaches: Use of knockout mutants for specific components of each pathway (e.g., ndhG mutants for NDH pathway; pgr5 or pgrl1 mutants for the alternative pathway).

  • Post-illumination fluorescence analysis: This is specific to NDH activity and not observed in PGR5/PGRL1-mediated CET .

  • Combined techniques: Applying these approaches under various environmental conditions and stress treatments can reveal the dynamic interplay between the two pathways.

The methodological workflow should include:

  • Baseline measurements of both pathways in wild-type plants

  • Specific pathway inhibition (genetic or chemical)

  • Measurement of electron transport rates, ATP production, and stress responses

  • Analysis of compensatory upregulation between pathways

What quality control measures are essential when producing and characterizing recombinant ndhG?

Rigorous quality control measures include:

  • Sequence verification: Confirming the correct sequence of the cloned ndhG gene from Acorus calamus, especially at positions known to affect function (e.g., position 7) .

  • Expression verification:

    • Western blot analysis using specific antibodies

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Functional validation:

    • Complementation studies in ndhG-deficient plants

    • In vitro electron transport assays

    • Proton pumping measurements

  • Structural validation:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to evaluate folding quality

    • Native PAGE to examine complex formation

  • Stability assessment:

    • Thermal shift assays

    • Time-course activity measurements

    • Resistance to degradation in various buffer conditions

When incorporating recombinant ndhG into studies, researchers should also include appropriate controls such as ndhG knockout plants and plants expressing well-characterized ndhG variants to benchmark functional properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.