Recombinant Acorus calamus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant Acorus calamus CP47 protein (UniProt ID: Q3V508) is a full-length, 508-amino-acid polypeptide expressed in E. coli with an N-terminal His tag . Key attributes include:

PropertyDetails
Molecular Weight~56 kDa (predicted from sequence)
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

The protein retains functional chlorophyll-binding domains essential for its role in PSII .

Functional Role in Photosystem II

CP47 serves dual roles:

  1. Light Harvesting: Transfers excitation energy to the PSII reaction center .

  2. Structural Scaffold: Assists in assembling the PSII core complex, particularly during D1 protein integration .

Studies show that CP47 assembly requires auxiliary factors like Pam68, which stabilizes nascent CP47 during chlorophyll insertion . Disruption of CP47 in A. calamus or related species leads to impaired PSII activity and reduced photosynthetic efficiency .

Research Applications

The recombinant CP47 protein is utilized in:

  • Structural Biology: High-resolution mapping of PSII complexes via cryo-EM .

  • Biochemical Assays: Investigating chlorophyll-protein interactions and OEC assembly .

  • Biotechnology: Engineering stress-tolerant crops by modifying PSII components .

Comparative Analysis With Other Species

Amino acid sequence alignment reveals 85–90% homology between A. calamus CP47 and homologs in Arabidopsis thaliana (PsbB) and Lactuca sativa (Q332V1) . Key differences include:

SpeciesUnique Features
A. calamusExtended C-terminal region with hydrophobic residues for membrane anchoring .
A. thalianaContains a conserved Cl⁻-binding site near the OEC .
L. sativaModified E-loop residues affecting OEC protein binding .

Future Research Directions

  1. Mechanistic Studies: Elucidate how CP47 coordinates with PsbH and Pam68 during PSII biogenesis .

  2. Thermostability: Engineer heat-tolerant CP47 variants for agricultural applications .

  3. Drug Discovery: Explore CP47 as a target for herbicides inhibiting photosynthetic pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQAV
Uniprot No.

Target Background

Function

Acorus calamus Photosystem II CP47 chlorophyll apoprotein (psbB) is a core component of the photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the initial light-induced photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Photosystem II CP47 chlorophyll apoprotein (psbB) and what is its role in Acorus calamus?

    Photosystem II CP47 chlorophyll apoprotein (psbB) is a core antenna chlorophyll binding subunit of Photosystem II in Acorus calamus and other photosynthetic organisms. As identified in the MetaCyc database, CP47 is made only when D1 has successfully assembled with D2, and its recruitment facilitates the further binding of the oxygen evolving enhancer (OEE) proteins . In Acorus calamus, this protein plays a crucial role in light harvesting and energy transfer within the photosynthetic apparatus.

    The protein is approximately 56.0 kD (based on nucleotide sequence) and is located in the chloroplast thylakoid . CP47 closely associates with the PSII reaction center complex and is positioned on one side of the complex, opposite to CP43. This positioning is critical for proper energy transfer from antenna pigments to the reaction center.

    Research methodology: Localization and functional studies of psbB typically involve isolation of thylakoid membranes, differential centrifugation, and immunoprecipitation with specific antibodies against CP47.

  • How is recombinant Acorus calamus psbB protein typically expressed and purified for research purposes?

    Recombinant Acorus calamus Photosystem II CP47 chlorophyll apoprotein is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The process involves:

    1. Gene cloning: The psbB gene is amplified from Acorus calamus genomic DNA or cDNA and inserted into a suitable expression vector.

    2. Transformation and expression: The recombinant vector is transformed into an E. coli strain optimized for protein expression. Expression is induced under controlled conditions.

    3. Cell lysis and protein extraction: Bacterial cells are lysed, and the recombinant protein is extracted.

    4. Purification: The His-tagged protein is purified using affinity chromatography (typically Ni-NTA resin).

    5. Quality control: The purified protein is analyzed by SDS-PAGE to assess purity (typically >90%) .

    6. Storage: The protein is stored in a suitable buffer containing glycerol at -20°C or -80°C to maintain stability .

    Research methodology: For successful reconstitution after lyophilization, it is recommended to briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage .

  • How does the sequence of Acorus calamus psbB compare to other plant species?

    Comparative analysis of the psbB protein sequence from Acorus calamus with other plant species reveals both conserved and variable regions. For instance, when comparing the sequence with Lactuca sativa (Garden lettuce) psbB and Welwitschia mirabilis psbB , there are high levels of conservation in functional domains, particularly in the chlorophyll-binding regions and interfaces for interaction with other PSII components.

    A sequence alignment table comparing key regions would show:

    SpeciesChlorophyll-binding motifD1/D2 interaction domainSequence identity
    Acorus calamusFVIPFMTRLGITNSWGGWSITGGTEKLAFYDYIGNNPAKGGLFRAG100% (reference)
    Lactuca sativaFVIPFMTRLGITNSWGGWSITGGTEKLAFYDYIGNNPAKGGLFRAG~98%
    Welwitschia mirabilisFILPFMTRLGIKESWGGWSITGEPEKLAFYDYIGNNPAKGGLFRAG~90%
    Arabidopsis thalianaFVLPFMARLGVTNSWGGWSITGETEKLAFYDYIGNNPAKGGLFRAG~95%

    Research methodology: Sequence comparison is typically performed using multiple sequence alignment tools such as MUSCLE or Clustal Omega, followed by phylogenetic analysis to determine evolutionary relationships.

  • What are the typical storage and handling conditions for recombinant psbB protein?

    Proper storage and handling of recombinant Acorus calamus psbB protein is critical for maintaining its stability and functionality. Based on supplier recommendations :

    Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

    Handling recommendations:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

    Storage buffer composition:

    • Tris/PBS-based buffer

    • 6% Trehalose

    • pH 8.0

    Research methodology: Protein stability can be monitored using techniques such as differential scanning fluorimetry (DSF) or circular dichroism (CD) spectroscopy to assess thermal stability and secondary structure integrity over time.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.