Recombinant Acorus calamus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Role in Photosynthesis

The D1 protein is essential for PSII’s electron transport chain, facilitating water oxidation and plastoquinone (Q<sub>B</sub>) binding. Studies on Acorus calamus under antimony (Sb) stress reveal:

  • Chlorophyll Reduction: High Sb concentrations reduce Chl a, Chl b, and carotenoid levels, impairing light absorption .

  • PSII Efficiency Decline: F<sub>v</sub>/F<sub>m</sub> (maximum quantum yield) and Φ<sub>PSII</sub> (effective quantum yield) decrease by ~30% under Sb stress, indicating photoinhibition .

  • Gas Exchange Impairment: Net photosynthetic rate (P<sub>n</sub>) and stomatal conductance (G<sub>s</sub>) drop by 38–66% under Sb<sup>3+</sup> exposure .

These findings underscore psbA’s sensitivity to environmental stressors and its role in maintaining photosynthetic efficiency.

Research Tools

  • ELISA and Immunoblotting: Used as a quantitation standard for PSII protein studies .

  • Stress Response Studies: Serves as a biomarker for evaluating heavy metal toxicity in plants .

  • Comparative Analysis: Enables cross-species functional studies, e.g., cyanobacterial PSII engineering .

Industrial Relevance

  • Herbicide Research: The D1 protein is a target for herbicides like atrazine; recombinant psbA aids in resistance mechanism studies .

  • Photosynthesis Optimization: Insights from recombinant psbA inform bioengineering strategies to enhance crop resilience .

Expression and Purification

The protein is expressed in E. coli or cell-free systems, followed by affinity chromatography (His-tag purification). Key steps include:

  1. Lyophilization: Stabilized in Tris/PBS buffer with trehalose or glycerol .

  2. Reconstitution: Optimized at 0.1–1.0 mg/mL in deionized water, with glycerol for long-term storage .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; single-use aliquots are recommended .

  • Functional Heterogeneity: Post-translational modifications (e.g., C-terminal processing) vary between species, affecting activity in chimeric PSII complexes .

Future research should prioritize structural resolution (e.g., cryo-EM) and stress-tolerant psbA variants for agricultural applications.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly include them in your order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Acorus calamus (Sweet flag)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently utilized for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein (psbA) and what is its function in Acorus calamus?

Photosystem Q(B) protein, also known as psbA or D1 protein, is a core component of Photosystem II in photosynthetic organisms including Acorus calamus. This protein plays a critical role in the electron transport chain during photosynthesis by binding to plastoquinone B (Q(B)) and facilitating electron transfer. The protein is encoded by the psbA gene located in the chloroplast genome and functions within the thylakoid membrane .

The protein consists of 344 amino acids in its full-length form and contains several transmembrane domains that anchor it within the thylakoid membrane. Its functional importance lies in its ability to coordinate with other Photosystem II proteins to enable light-harvesting and the water-splitting reaction that generates molecular oxygen .

What are the recommended storage and handling conditions for recombinant psbA protein?

For optimal stability and activity of recombinant Acorus calamus psbA protein:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)
Freeze-thaw cyclesAvoid repeated cycles

Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. After reconstitution, the protein solution should be aliquoted to minimize freeze-thaw damage .

What expression systems are most effective for producing recombinant A. calamus psbA protein?

The most common expression system for recombinant photosynthetic proteins, including A. calamus psbA, is Escherichia coli. Based on available product information, successful expression has been achieved using E. coli systems with appropriate modifications to enhance proper folding and stability .

For optimal expression:

  • Codon optimization: The plant-derived gene sequence should be optimized for bacterial expression

  • Fusion tags: His-tags are commonly employed to facilitate purification while minimizing impact on protein structure

  • Expression conditions: Lower temperatures (16-25°C) often yield better results than standard 37°C incubation

  • Solubilization strategies: Membrane proteins like psbA may require specialized solubilization agents

While E. coli remains the predominant system, alternative expression platforms such as insect cells or plant-based expression systems might provide advantages for maintaining proper folding of this complex membrane protein.

How can researchers verify the structural integrity of recombinant psbA after purification?

Verification of structural integrity for recombinant psbA protein should employ multiple complementary techniques:

  • SDS-PAGE analysis: To confirm protein purity and expected molecular weight (~38 kDa)

  • Western blotting: Using anti-His antibodies (for tagged proteins) or specific anti-psbA antibodies

  • Circular dichroism (CD) spectroscopy: To assess secondary structure elements

  • Size exclusion chromatography: To evaluate oligomeric state and aggregation

  • Functional assays: Measuring electron transport activity or plastoquinone binding

Researchers should aim for greater than 90% purity as determined by SDS-PAGE before proceeding to functional studies . Comparison with native protein isolated from A. calamus chloroplasts can provide valuable benchmarks for structural assessment.

What are the primary research applications for recombinant A. calamus psbA protein?

Recombinant A. calamus psbA protein serves several critical research applications:

  • Photosynthesis research: Investigating electron transport mechanisms and energy transfer in PSII

  • Structural biology: Crystallography studies of plant-specific photosystem components

  • Herbicide research: Understanding binding mechanisms of herbicides targeting D1 protein

  • Evolutionary studies: Comparative analysis with psbA from other species to elucidate evolutionary relationships

  • Environmental stress research: Examining how environmental factors affect photosystem proteins

  • Antibody production: Generating specific antibodies for photosystem research

The protein can be particularly valuable for researchers studying unique adaptations of A. calamus to its aquatic and wetland habitats, potentially revealing specialized photosynthetic mechanisms .

How can recombinant psbA protein be incorporated into artificial membrane systems for functional studies?

Methodology for incorporating recombinant psbA into artificial membrane systems:

  • Liposome preparation:

    • Create liposomes using phosphatidylcholine and phosphatidylglycerol (7:3 ratio)

    • Hydrate lipid films with buffer containing 20 mM HEPES (pH 7.5), 100 mM NaCl

    • Extrude through polycarbonate membranes (100-200 nm pore size)

  • Protein reconstitution:

    • Solubilize purified psbA in mild detergent (0.05% DDM or 0.5% CHAPS)

    • Add solubilized protein to preformed liposomes at 1:100 protein:lipid ratio

    • Remove detergent using Bio-Beads or dialysis

  • Verification of incorporation:

    • Sucrose density gradient centrifugation to separate proteoliposomes

    • Freeze-fracture electron microscopy to visualize protein distribution

    • Fluorescence spectroscopy to assess protein orientation

  • Functional analysis:

    • Measure electron transport using artificial electron donors/acceptors

    • Assess plastoquinone binding using fluorescence quenching methods

    • Monitor reactive oxygen species generation under illumination

This methodology allows researchers to study the function of psbA in a controlled environment that mimics the native thylakoid membrane.

How does psbA protein from A. calamus compare with those from other photosynthetic organisms?

The psbA protein from Acorus calamus exhibits both conserved and unique features when compared to other photosynthetic organisms:

Organism TypeKey DifferencesEvolutionary Implications
CyanobacteriaHigher mutation rate in A. calamus psbAIndependent adaptation to diverse light conditions
AlgaeDifferent D1 protein turnover ratesAdaptation to different aquatic environments
Other angiospermsVariations in herbicide-binding domainsReflects different evolutionary pressures from herbivory
Bryophytes (e.g., Conocephalum)Different amino acid composition in transmembrane helicesAdaptation to different habitat moisture levels

Particularly notable is the comparison with Conocephalum conicum (liverwort) psbA, which despite being evolutionarily distant, maintains the core functional domains required for photosynthetic electron transport . These comparative analyses provide insights into how photosynthetic machinery has evolved across different plant lineages.

What insights can recombinant psbA studies provide about A. calamus adaptation to aquatic environments?

Recombinant psbA protein studies can reveal unique adaptations of Acorus calamus to wetland and aquatic environments:

  • Oxygen evolution rates: Potentially higher stability under fluctuating oxygen tensions

  • Plastoquinone binding kinetics: May show adaptations for function under partially submerged conditions

  • Thermal stability profiles: Could reveal adaptations to temperature fluctuations typical in aquatic environments

  • Photoprotection mechanisms: May exhibit enhanced damage-repair cycles for high light exposure in open wetlands

  • pH sensitivity: Could show broader pH tolerance reflective of variable water conditions

These studies align with ecological observations showing A. calamus has successfully naturalized in wetland environments across multiple continents, suggesting effective photosynthetic adaptation to aquatic conditions .

What are the main challenges in expressing plant membrane proteins like psbA in prokaryotic systems?

Expressing plant membrane proteins such as psbA in prokaryotic systems presents several significant challenges:

  • Codon usage bias: Plant chloroplast genes use different codon preferences than E. coli

  • Post-translational modifications: Bacterial systems lack machinery for plant-specific modifications

  • Membrane insertion: Proper folding and insertion into membranes often fails in prokaryotic systems

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt bacterial membrane integrity

  • Protein solubility: Tendency to form inclusion bodies requires optimization of solubilization conditions

  • Co-factor incorporation: Chlorophyll and other co-factors necessary for proper folding are absent

  • Proper disulfide bond formation: Oxidizing environment for correct disulfide bridges may be lacking

To overcome these challenges, researchers often employ:

  • Specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression

  • Lower induction temperatures (16-20°C)

  • Fusion with solubility-enhancing tags (MBP, SUMO)

  • Co-expression with chloroplast chaperones

  • Cell-free expression systems with added lipids or detergents

How can researchers assess the functional activity of recombinant psbA compared to the native protein?

Assessment of recombinant psbA functional activity requires multiple complementary approaches:

  • Electron transport assays:

    • Measure electron transfer rates using artificial electron donors/acceptors

    • Compare kinetic parameters (Km, Vmax) with those of native protein

    • Assess inhibition profiles using known PSII inhibitors

  • Binding studies:

    • Quantify plastoquinone binding using fluorescence quenching

    • Determine herbicide binding constants for known D1-targeting herbicides

    • Assess co-factor binding (chlorophyll, manganese)

  • Spectroscopic analysis:

    • Circular dichroism to compare secondary structure

    • FTIR spectroscopy to analyze protein-lipid interactions

    • EPR spectroscopy to examine redox centers

  • Thermal stability comparisons:

    • Differential scanning calorimetry to measure unfolding temperatures

    • Thermal shift assays to assess ligand-induced stabilization

  • Integration into model membranes:

    • Reconstitution into liposomes or nanodiscs

    • Comparison of activity in reconstituted systems to native thylakoid membranes

A combination of these approaches provides a comprehensive assessment of whether recombinant psbA maintains native-like functional properties .

How can researchers use recombinant A. calamus psbA protein to study herbicide resistance mechanisms?

Recombinant A. calamus psbA protein offers valuable tools for studying herbicide resistance through several methodological approaches:

  • Site-directed mutagenesis studies:

    • Generate specific mutations in the psbA sequence known to confer herbicide resistance

    • Express and purify the mutant proteins alongside wild-type

    • Compare binding affinities and inhibition constants for various herbicides

  • Herbicide binding assays:

    • Utilize isothermal titration calorimetry to measure binding thermodynamics

    • Employ fluorescence polarization to assess direct binding of fluorescently labeled herbicides

    • Conduct competitive binding assays with multiple herbicides to identify binding site overlap

  • Structural studies:

    • Perform co-crystallization of recombinant psbA with herbicides

    • Use hydrogen-deuterium exchange mass spectrometry to identify herbicide binding interfaces

    • Apply molecular dynamics simulations based on experimental structures

  • Electron transport measurements:

    • Compare herbicide inhibition profiles between wild-type and resistant variants

    • Establish dose-response curves to determine IC50 values

    • Measure recovery kinetics after herbicide removal

These approaches can illuminate the molecular basis of herbicide resistance in A. calamus, which has traditionally been used as an insecticide and antifungal agent but might have developed resistance mechanisms against environmental toxins .

What potential exists for engineering enhanced photosynthetic efficiency through psbA modifications?

Engineering enhanced photosynthetic efficiency through psbA modifications represents an advanced research frontier with several promising approaches:

  • Rational design strategies:

    • Modify amino acids in the electron transfer chain to optimize electron flow rates

    • Engineer D1 protein turnover rates to improve repair cycles under high light conditions

    • Alter binding pocket residues to enhance plastoquinone exchange rates

  • Directed evolution approaches:

    • Develop high-throughput screening systems for psbA variants

    • Select for variants with improved thermal stability

    • Identify mutations that reduce photoinhibition

  • Chimeric protein engineering:

    • Create chimeric proteins incorporating beneficial domains from different species

    • Combine regions from cyanobacterial and plant psbA to optimize specific functions

    • Develop hybrid proteins with enhanced stability in fluctuating environments

  • Computational predictions:

    • Use molecular dynamics simulations to predict beneficial mutations

    • Apply machine learning to identify patterns in natural psbA sequence variations

    • Model electron transfer kinetics to identify rate-limiting steps

Successful engineering would require careful validation in reconstituted systems, followed by chloroplast transformation experiments to assess performance in vivo. These approaches could potentially lead to crops with improved photosynthetic efficiency, particularly under stress conditions .

How does psbA protein interact with other components of Photosystem II in A. calamus?

The psbA (D1) protein forms extensive interactions with multiple proteins and cofactors within the Photosystem II complex:

  • Core protein interactions:

    • Forms heterodimer with D2 protein (psbD)

    • Interacts with CP43 and CP47 chlorophyll-binding proteins

    • Associates with cytochrome b559 components (psbE/F)

  • Cofactor coordination:

    • Binds multiple chlorophyll a molecules

    • Coordinates manganese ions in the oxygen-evolving complex

    • Contains binding sites for plastoquinone (QB site)

    • Interacts with non-heme iron between QA and QB sites

  • Lipid interactions:

    • Specific binding sites for phosphatidylglycerol

    • Stabilizing interactions with monogalactosyldiacylglycerol

  • Dynamic associations:

    • Interacts with repair proteases during damage-repair cycles

    • Transiently associates with chaperones during assembly

These interactions collectively enable the coordinated electron transport and water-splitting functions of Photosystem II. The specific properties of A. calamus psbA might reflect adaptations to its aquatic environment, potentially showing modifications in protein-protein interfaces that enhance stability under fluctuating water conditions .

What methods can researchers use to study the turnover and repair cycle of psbA protein?

The D1 (psbA) protein undergoes the highest turnover rate of all photosynthetic proteins due to photodamage. Researchers can study this critical repair cycle using:

  • Pulse-chase labeling:

    • Label newly synthesized proteins with radioisotopes or non-canonical amino acids

    • Track degradation and replacement rates under various light conditions

    • Compare turnover rates between different species or mutants

  • Fluorescent tagging approaches:

    • Engineer fluorescent protein fusions for live imaging

    • Apply Fluorescence Recovery After Photobleaching (FRAP) to measure mobility

    • Use Förster Resonance Energy Transfer (FRET) to detect protein-protein interactions during repair

  • Protease assays:

    • Identify specific proteases involved in damaged D1 degradation

    • Compare proteolytic fragments under different damage conditions

    • Apply protease inhibitors to track accumulation of damaged protein

  • Quantitative mass spectrometry:

    • Measure absolute quantities of D1 protein under various conditions

    • Identify post-translational modifications associated with damage signals

    • Track changes in interacting proteins during repair cycle

  • Biochemical reconstitution:

    • Reconstitute repair cycle components in vitro

    • Systematically test factors affecting repair efficiency

    • Compare kinetics between recombinant and native systems

These methodologies provide insights into how plants like A. calamus maintain photosynthetic efficiency under changing environmental conditions, particularly in aquatic environments where light intensity can fluctuate rapidly .

What emerging technologies might enhance our understanding of psbA protein function?

Several cutting-edge technologies are poised to revolutionize psbA protein research:

  • Cryo-electron microscopy advances:

    • Higher resolution structures of plant-specific PSII complexes

    • Time-resolved structural changes during electron transport

    • Visualization of herbicide binding in native conformation

  • Single-molecule techniques:

    • Atomic Force Microscopy to measure protein-protein interaction forces

    • Single-molecule FRET to detect conformational changes during function

    • Optical tweezers to measure mechanical properties of protein domains

  • Advanced spectroscopy:

    • Ultrafast transient absorption spectroscopy to track electron movement

    • Multi-dimensional NMR to study dynamics in membrane environment

    • Neutron scattering to locate hydrogen atoms in critical catalytic sites

  • Synthetic biology approaches:

    • Minimal synthetic PSII systems with defined components

    • Incorporation of non-canonical amino acids for novel functions

    • Development of orthogonal translation systems in chloroplasts

  • Computational advances:

    • Quantum mechanics/molecular mechanics simulations of electron transfer

    • Deep learning prediction of protein-protein interaction networks

    • Whole-cell models incorporating photosynthetic processes

These technologies will enable researchers to address fundamental questions about photosynthetic efficiency and potentially develop applications in artificial photosynthesis and crop improvement .

How might research on A. calamus psbA contribute to understanding plant adaptation to climate change?

Research on A. calamus psbA protein has significant potential to illuminate plant adaptation mechanisms relevant to climate change:

  • Temperature adaptation studies:

    • Compare thermal stability profiles between populations from different climates

    • Identify structural features conferring resilience to temperature fluctuations

    • Develop predictive models for photosynthetic performance under warming scenarios

  • Drought response mechanisms:

    • Examine psbA modifications in response to water limitation

    • Identify protective mechanisms against reactive oxygen species during drought

    • Compare repair cycle efficiency under drought conditions

  • CO2 response pathways:

    • Investigate how elevated CO2 affects psbA turnover and repair

    • Examine interactions between carbon fixation and electron transport regulation

    • Identify bottlenecks in photosynthetic efficiency under changing CO2 levels

  • Adaptation to light quality changes:

    • Study how changing cloud cover affects photodamage and repair mechanisms

    • Examine adaptation to increased UV radiation

    • Identify protective mechanisms against photoinhibition

A. calamus presents a particularly valuable model as it has successfully adapted to diverse environments worldwide after being introduced from Asia, demonstrating remarkable adaptability that may inform our understanding of plant resilience mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.