Recombinant Actinobacillus pleuropneumoniae serotype 3 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction to Actinobacillus pleuropneumoniae and Fumarate Reductase

Actinobacillus pleuropneumoniae is a significant bacterial pathogen that causes fibrinous pleuropneumonia in pigs, a severe respiratory disease with substantial economic impact on the swine industry worldwide. A key aspect of A. pleuropneumoniae's pathogenicity is its ability to persist in the anaerobic environment of infected lung tissue, where oxygen is limited . Under these conditions, the bacterium employs alternative respiratory pathways, with fumarate reductase playing a crucial role in this metabolic adaptation.

Fumarate reductase (FRD) catalyzes the reduction of fumarate to succinate, serving as the terminal step in anaerobic respiration when fumarate acts as the terminal electron acceptor instead of oxygen . This enzyme is particularly important for A. pleuropneumoniae's ability to survive and proliferate in the oxygen-depleted environment of infected tissues. Research has demonstrated that mutation of the fumarate reductase genes in A. pleuropneumoniae significantly attenuates its virulence, highlighting the enzyme's importance in pathogenesis .

Metabolic Context and Significance

The ArcAB two-component system in A. pleuropneumoniae regulates metabolic adaptation in response to anaerobic conditions, and studies have shown that an ArcA mutant exhibits reduced virulence compared to the wild type . Transcriptome and proteome analyses have revealed that the ArcA regulon impacts the expression of numerous genes involved in fumarate metabolism. Specifically, ArcA negatively regulates the expression of enzymes that consume intermediates during fumarate synthesis while simultaneously upregulating the expression of glycerol-3-phosphate dehydrogenase, which serves as a direct reduction equivalent for fumarate reductase .

These findings, coupled with the observation that A. pleuropneumoniae lacks an oxidative branch of the citric acid cycle, suggest that fumarate reductase plays a dual role in virulence: providing energy via fumarate respiration and generating essential metabolic intermediates through the reductive branch of the citric acid cycle .

Structure and Function of Fumarate Reductase Complex

Fumarate reductases can be categorized into two major groups based on their structure and cellular localization. The fumarate reductase found in A. pleuropneumoniae belongs to the first group, consisting of membrane-bound enzymes typically composed of three or four subunits .

Components of the Fumarate Reductase Complex

The membrane-bound fumarate reductase complex in bacteria like A. pleuropneumoniae consists of four subunits encoded by the frdABCD operon:

  1. FrdA: The catalytic subunit that contains the active center where fumarate is reduced to succinate

  2. FrdB: An iron-sulfur subunit that transfers electrons to FrdA from the anchor subunits

  3. FrdC: A membrane anchor subunit that accepts electrons from quinols

  4. FrdD: A second membrane anchor subunit that works with FrdC to anchor the complex to the membrane and participate in electron transfer

The amino acid sequences of FrdA and FrdB are highly conserved across diverse bacterial species, reflecting their crucial enzymatic functions . In contrast, the membrane anchor subunits FrdC and FrdD show greater variability, possibly reflecting adaptations to different membrane environments.

Electron Transfer and Enzymatic Mechanism

In the fumarate reductase complex, the FrdC and FrdD subunits accept electrons from quinols and transfer them to FrdB. FrdB then transfers these electrons to FrdA, where fumarate is reduced to succinate . This electron transfer chain creates a proton gradient across the membrane, contributing to energy conservation in the form of a proton motive force that can drive ATP synthesis.

The midpoint potentials for the glycerol-3-phosphate/dihydroxyacetone phosphate and the fumarate/succinate redox pairs are −0.19 V and 0 V, respectively, making the coupling of these systems thermodynamically favorable for energy conservation . This electron transfer pathway becomes particularly important when oxygen is unavailable as a terminal electron acceptor.

Functional Significance of FrdD

As a membrane anchor subunit, FrdD contributes to:

  1. Structural stability of the fumarate reductase complex within the bacterial membrane

  2. Electron transfer from quinols to the iron-sulfur centers in FrdB

  3. Maintenance of the proper orientation of the complex for efficient electron transfer

  4. Generation of the proton gradient necessary for energy conservation

While the FrdA and FrdB subunits are often the focus of catalytic studies, the membrane anchor subunits like FrdD are essential for the proper functioning of the complex in its native environment. Without these anchor subunits, the catalytic components would not be properly positioned within the membrane to participate in the respiratory chain.

Genetic Organization

In typical fumarate reductases, the genes encoding the subunits are assembled in a cluster as an operon (frdABCD) . This genetic organization ensures coordinated expression of all components of the complex. In A. pleuropneumoniae, the fumarate reductase genes are similarly organized, allowing for the regulated expression of the complete enzyme complex in response to changing environmental conditions, particularly oxygen availability .

Recombinant FrdD from A. pleuropneumoniae Serotype 3

Recombinant Actinobacillus pleuropneumoniae serotype 3 Fumarate reductase subunit D (frdD) refers to the FrdD protein that has been produced using recombinant DNA technology. This approach allows for the isolation and study of the individual subunit outside its native context, enabling detailed structural and functional analyses.

Production of Recombinant FrdD

The production of recombinant FrdD typically involves cloning the frdD gene from A. pleuropneumoniae serotype 3 into an expression vector, transforming this construct into a suitable host organism (often Escherichia coli), and inducing expression of the protein. The recombinant protein may include affinity tags to facilitate purification, such as polyhistidine tags that allow for immobilized metal affinity chromatography .

Commercial suppliers like CUSABIO TECHNOLOGY LLC offer recombinant A. pleuropneumoniae serotype 3 FrdD protein for research purposes . These commercially available recombinant proteins provide researchers with standardized reagents for various applications in microbiology, immunology, and drug development.

Research Applications and Significance

The study of recombinant A. pleuropneumoniae FrdD and the fumarate reductase complex has significant implications for both basic research and applied sciences.

Insights into Bacterial Metabolism and Pathogenesis

Research on fumarate reductase has provided valuable insights into the metabolic adaptations of A. pleuropneumoniae under anaerobic conditions. Studies using deletion mutants have demonstrated that the fumarate reductase complex is crucial for virulence in pig infection models .

Pigs infected with an A. pleuropneumoniae Δfrd mutant showed significantly reduced lung lesion scores compared to those infected with the wild type. Moreover, the quality of lung lesions differed substantially; while wild-type infection caused severe fibrinous pleuropneumonia and moderate focal purulent pneumonia with abscess formation, the Δfrd mutant produced only mild bronchiolo-interstitial pneumonia . These findings highlight the importance of fumarate reductase in the pathogenesis of A. pleuropneumoniae infection.

Potential for Therapeutic and Vaccine Development

The attenuation of virulence observed in fumarate reductase mutants suggests that this enzyme complex, including the FrdD subunit, could serve as a target for therapeutic interventions or vaccine development against A. pleuropneumoniae infections . Recombinant FrdD might be used to develop subunit vaccines or to screen for inhibitors that could be developed into antimicrobial agents specific to A. pleuropneumoniae.

The following table summarizes the impact of fumarate reductase deletion on A. pleuropneumoniae virulence:

ParameterWild Type A. pleuropneumoniaeA. pleuropneumoniae Δfrd Mutant
Clinical ScoreHighReduced (not statistically significant)
Reisolation ScoreHighReduced (not statistically significant)
Lung Lesion ScoreHighSignificantly reduced (P ≤ 0.05)
Lung PathologySevere fibrinous pleuropneumonia; moderate focal purulent pneumonia with abscess formationMild bronchiolo-interstitial pneumonia

Table 1: Comparison of virulence parameters between wild type A. pleuropneumoniae and the Δfrd mutant in a pig aerosol infection model .

Genetic Engineering Approaches

To produce recombinant FrdD, researchers typically employ genetic engineering techniques to isolate and manipulate the frdD gene. While specific methods for A. pleuropneumoniae serotype 3 FrdD were not detailed in the search results, general approaches for similar proteins involve:

  1. PCR amplification of the frdD gene from A. pleuropneumoniae serotype 3 genomic DNA

  2. Cloning into an expression vector with appropriate regulatory elements

  3. Transformation into a host expression system

  4. Induction of protein expression under controlled conditions

  5. Extraction and purification of the recombinant protein

Construction of deletion mutants for functional studies involves similar genetic engineering approaches. For example, researchers have constructed A. pleuropneumoniae Δfrd mutants by deleting portions of the frd operon and confirming the mutations through techniques such as PCR, Southern blotting, nucleotide sequencing analysis, and pulsed-field gel electrophoresis .

Purification and Enzymatic Activity Assessment

While specific purification protocols for A. pleuropneumoniae FrdD were not provided in the search results, fumarate reductase activity can be assessed through various enzymatic assays. For instance, a common approach involves measuring the consumption of NADH in the presence of fumarate spectrophotometrically at 340 nm .

The table below illustrates a typical purification scheme for a bacterial fumarate reductase, which might be adapted for the purification of recombinant A. pleuropneumoniae FrdD:

FractionTotal Activity (U)Total Protein (mg)Specific Activity (U/mg)Purification Factor (fold)Yield (%)
Cell-Free Extract1,3003,8000.351.0100
Butyl-Toyopearl6002302.67.546
DEAE-Toyopearl250347.52119
Hydroxyapatite1103.630878.5
MonoQ390.77501403.0
Phenyl Superose3.50.049712000.27

Table 2: Representative purification scheme for a bacterial fumarate reductase, showing progressive enrichment of specific activity through multiple chromatographic steps .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please include them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
frdD; APJL_1553; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Target Names
frdD
Target Protein Sequence
MNKQDPKRSNEPPVWLMFSAGGTISAICFPVLLLILGVLLPLGLVPVENIVAFAHTWFGK LVILAVTIFPMWAGMHRVHHGLHDLKIHFPAGGWVFYGLSALYSVIVFFAVIAL
Uniprot No.

Target Background

Function
This protein anchors the catalytic components of the fumarate reductase complex to the cell membrane. It also binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of fumarate reductase in A. pleuropneumoniae pathogenesis?

Fumarate reductase plays a dual critical role in A. pleuropneumoniae pathogenesis by: (1) serving as a key component of anaerobic respiration, providing energy through fumarate respiration, and (2) generating essential metabolic intermediates via the reductive branch of the citric acid cycle, particularly succinate . This enzyme allows A. pleuropneumoniae to persist in oxygen-limited environments within the porcine respiratory tract by utilizing fumarate as a terminal electron acceptor . Research has demonstrated that deletion of the fumarate reductase genes (frdABCD) results in significant attenuation of virulence in infection models, with infected animals showing milder bronchiolo-interstitial pneumonia compared to the severe fibrinous pleuropneumonia seen with wild-type infection . The importance of this enzyme is particularly evident in the anaerobic microenvironment of the respiratory epithelium, where oxygen availability is restricted.

How is the frdABCD operon organized in the A. pleuropneumoniae genome?

The fumarate reductase enzyme in A. pleuropneumoniae is encoded by the frdABCD operon. Based on genomic analyses, this operon contains four genes that encode the respective subunits of the enzyme complex . The operon structure follows the typical organization seen in related organisms:

  • frdA: Encodes the catalytic flavoprotein subunit

  • frdB: Encodes the iron-sulfur protein subunit

  • frdC: Encodes the membrane anchor protein

  • frdD: Encodes the membrane anchor protein

The frdD gene specifically encodes one of the membrane-anchoring subunits that helps tether the catalytic portions of the enzyme to the cytoplasmic membrane. When creating deletion mutants for experimental studies, researchers have successfully deleted portions of the frdA gene to inactivate the entire enzyme complex, as demonstrated in the methodology used by Buettner et al. .

What experimental approaches can confirm fumarate reductase activity in laboratory settings?

The measurement of fumarate reductase activity requires specific enzymatic assays that track the consumption of NADH in the presence of fumarate. A standard methodological approach involves:

  • Preparation of bacterial whole-cell lysates under controlled growth conditions

  • Spectrophotometric measurement at 340 nm using a reaction mixture containing sodium fumarate (typically 8.4 mM), NADH (approximately 116.3 μM), and an appropriate buffer such as Tris (pH 7.3)

  • Initiation of the reaction by adding an equal volume of bacterial lysate

  • Monitoring the decrease in absorbance as NADH is oxidized in the fumarate reduction reaction

This methodology allows researchers to quantitatively compare fumarate reductase activity between wild-type strains, deletion mutants, and complemented strains. Decreased NADH consumption indicates reduced fumarate reductase activity, as observed in frd deletion mutants .

How does the ArcA transcriptional regulator affect fumarate reductase expression in A. pleuropneumoniae?

The ArcA transcriptional regulator plays a complex role in modulating the expression of genes involved in the fumarate respiratory pathway of A. pleuropneumoniae. While the fumarate reductase genes themselves appear to be constitutively expressed, ArcA orchestrates a coordinated regulation of the metabolic pathway leading to fumarate synthesis and utilization . Specifically:

  • ArcA upregulates the expression of glycerol-3-phosphate dehydrogenase (glpABC), which is critical for generating the electron donor for fumarate reduction

  • ArcA simultaneously downregulates competing metabolic pathways, including:

    • Pyruvate dehydrogenase complex components (aceE, aceF, lpdA) – reduced approximately 3-fold

    • Malate:quinone oxidoreductase (mqo) – downregulated 20-fold

    • Malic enzyme (maeB) – downregulated 4.6-fold

This regulatory pattern demonstrates how ArcA optimizes metabolism toward fumarate respiration under anaerobic conditions by both promoting the fumarate reduction pathway and suppressing competing metabolic routes. Researchers investigating ArcA's role should consider both transcriptomic (microarray) and proteomic (2D-DIGE) approaches to fully capture these regulatory effects .

What methods are effective for creating and validating A. pleuropneumoniae frdD deletion mutants?

Creating and validating A. pleuropneumoniae frdD deletion mutants involves a multi-step process that can be summarized in the following methodological framework:

  • Construction of the deletion vector:

    • Amplify approximately 1,300 bp fragments upstream and downstream of the targeted deletion region

    • Clone these fragments into an appropriate vector system (e.g., pCR2.1-TOPO, followed by transfer to a suicide vector like pEMOC2)

    • Ensure the creation of an in-frame deletion to prevent polar effects on downstream genes

  • Bacterial conjugation and mutant selection:

    • Introduce the deletion construct via conjugation (e.g., using E. coli β2155 as donor)

    • Select for appropriate antibiotic resistance markers

    • Screen for double crossover events that result in allelic exchange

  • Validation of the mutant:

    • PCR verification of the deletion

    • Southern blot analysis to confirm proper recombination

    • DNA sequencing across the recombination junctions

    • Pulsed-field gel electrophoresis to ensure no genomic rearrangements occurred

  • Functional verification:

    • Enzymatic assays to confirm the loss of fumarate reductase activity

    • Complementation in trans with a plasmid containing the wild-type gene to restore function

    • Growth characterization under aerobic and anaerobic conditions

This comprehensive validation approach ensures that any phenotypic changes observed in the mutant are specifically attributable to the loss of fumarate reductase activity rather than to secondary genomic alterations.

How does fumarate reductase interact with other components of the electron transport chain in A. pleuropneumoniae?

In A. pleuropneumoniae, fumarate reductase functions as part of a specialized anaerobic electron transport chain that is directly coupled to glycerol-3-phosphate dehydrogenase . This interaction forms a simple but effective respiratory chain with the following characteristics:

  • Electron flow pathway:

    • Glycerol-3-phosphate serves as the primary electron donor

    • Glycerol-3-phosphate dehydrogenase (encoded by glpABC) oxidizes glycerol-3-phosphate to dihydroxyacetone phosphate

    • Electrons are transferred directly to the fumarate reductase complex

    • Fumarate reductase (FrdABCD) uses these electrons to reduce fumarate to succinate

  • Energetic considerations:

    • The midpoint potentials for the glycerol-3-phosphate/dihydroxyacetone phosphate and fumarate/succinate redox pairs are -0.19 V and 0 V, respectively

    • This energetic coupling generates a proton gradient across the cytoplasmic membrane that can drive ATP synthesis

  • Integration with metabolism:

    • The dihydroxyacetone phosphate generated can enter glycolysis

    • It can subsequently be converted to phosphoenolpyruvate and then oxaloacetate

    • Oxaloacetate enters the reductive branch of the TCA cycle to generate malate and ultimately fumarate

This tightly integrated system allows A. pleuropneumoniae to efficiently generate energy under anaerobic conditions while maintaining redox balance, which is crucial for survival in the oxygen-limited environment of infected lung tissue.

Advanced Research Questions

While the search results don't provide direct comparisons between mutations in different frd subunits, we can outline a research approach to investigate this question:

The methodology used for constructing and validating the frdA deletion described in the search results provides a template that could be adapted for creating and characterizing an frdD-specific mutant .

What therapeutic approaches targeting fumarate reductase show promise for controlling A. pleuropneumoniae infections?

The critical role of fumarate reductase in A. pleuropneumoniae virulence makes it an attractive therapeutic target. Several potential approaches deserve further investigation:

  • Fumarate reductase inhibitors:

    • Nafuredin, a non-commercial anthelminthic compound that inhibits fumarate reductase, has shown efficacy against Haemonchus contortus infections in sheep

    • This compound could potentially be repurposed or serve as a lead compound for developing treatments against A. pleuropneumoniae

    • Three other known inhibitory compounds exist but were deemed unsuitable for therapeutic use in prior studies

  • Advantage as a therapeutic target:

    • Higher eukaryotes (including pigs) do not possess homologues to bacterial fumarate reductase

    • This minimizes the risk of host toxicity and allows for selective targeting

  • Broader applications:

    • Similar approaches might be effective against other bacterial pathogens that colonize mucosal surfaces and use fumarate respiration

    • This includes respiratory and gastrointestinal pathogens where anaerobic metabolism is important for colonization

  • Research directions:

    • Structure-based drug design targeting the unique aspects of A. pleuropneumoniae FrdD

    • High-throughput screening for novel inhibitors with improved pharmacokinetic properties

    • Development of delivery systems for respiratory targeting of inhibitors

The promising results from helminth studies suggest that fumarate reductase inhibition represents a viable therapeutic strategy that warrants further investigation .

How does the oxygen level in experimental systems affect the expression and activity of recombinant A. pleuropneumoniae fumarate reductase?

The expression and activity of fumarate reductase in A. pleuropneumoniae is intricately linked to oxygen availability through the ArcAB two-component regulatory system. Researchers should consider the following methodological factors when working with recombinant fumarate reductase:

  • Oxygen-dependent regulation:

    • The ArcA regulon responds to anaerobic conditions by orchestrating metabolic shifts toward fumarate respiration

    • Under aerobic conditions, competing metabolic pathways are predominant

  • Experimental design considerations:

    • Strictly controlled oxygen levels are essential for reproducible results

    • Methods include:

      • Anaerobic chambers with defined gas mixtures

      • Sealed culture vessels with oxygen-scavenging systems

      • Continuous monitoring of dissolved oxygen using appropriate probes

  • Expression systems optimization:

    • For recombinant expression, promoter selection is critical:

      • Native promoters will maintain oxygen-responsive regulation

      • Constitutive promoters may allow oxygen-independent expression

      • Inducible systems can decouple expression from oxygen levels

  • Activity measurement protocols:

    • Enzymatic assays should be performed under anaerobic conditions to preserve native activity

    • Oxygen exposure during sample preparation may affect results

    • Control experiments should include measurements at defined oxygen concentrations

These considerations are essential for researchers working with recombinant A. pleuropneumoniae fumarate reductase to ensure that experimental conditions adequately reflect the physiological environment where this enzyme functions.

What are the key structural features of the FrdD subunit that contribute to its membrane anchoring function?

The FrdD subunit serves as one of two membrane anchor proteins (along with FrdC) that tether the catalytic components of fumarate reductase to the cytoplasmic membrane. While the search results don't provide detailed structural information specific to A. pleuropneumoniae FrdD, we can outline the expected structural features based on homologous proteins:

  • Transmembrane helices:

    • FrdD likely contains multiple transmembrane alpha-helical domains that span the cytoplasmic membrane

    • These hydrophobic regions anchor the entire complex to the membrane

  • Interaction domains:

    • Specific residues that interact with the FrdC subunit to form a stable membrane anchor complex

    • Regions that interact with the catalytic FrdA and FrdB subunits to position them properly for electron transfer

  • Functional elements:

    • Potential quinone-binding sites that facilitate electron transfer from the respiratory chain

    • Structural features that contribute to proton translocation coupled to the reduction of fumarate

The absence of a detailed structural characterization of A. pleuropneumoniae FrdD presents an opportunity for researchers to employ techniques such as X-ray crystallography, cryo-electron microscopy, or computational modeling to elucidate these features.

What expression systems and purification strategies are most effective for producing recombinant A. pleuropneumoniae FrdD?

Based on the information available in the search results and general principles for membrane protein expression, the following methodological approach can be recommended:

  • Expression system selection:

    • E. coli-based systems using specialized strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Expression vectors with tunable promoters to prevent toxicity from membrane protein overexpression

    • Consideration of fusion tags that can facilitate both expression and purification

  • Optimized expression conditions:

    • Lower temperatures (16-25°C) to slow protein synthesis and facilitate proper membrane insertion

    • Induction at mid-log phase with reduced inducer concentrations

    • Addition of membrane-stabilizing compounds to the growth medium

  • Membrane preparation and solubilization:

    • Gentle cell disruption methods to preserve membrane integrity

    • Differential centrifugation to isolate membrane fractions

    • Screening of detergents for optimal solubilization (e.g., DDM, LMNG, or digitonin)

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography to separate properly folded protein from aggregates

    • Consideration of lipid addition during purification to maintain protein stability

For validation of recombinant FrdD, researchers should consider functional assays measuring the ability of the purified protein to associate with other Frd subunits and support fumarate reductase activity when reconstituted into liposomes.

How can fumarate reductase be utilized as a target for vaccine development against A. pleuropneumoniae?

The potential of fumarate reductase as a vaccine target stems from its essential role in A. pleuropneumoniae virulence and its exposure to the immune system during infection. A methodological framework for vaccine development targeting this enzyme includes:

  • Antigen design strategies:

    • Recombinant expression of extracellular or surface-exposed portions of the FrdD and FrdC subunits

    • Identification of immunodominant epitopes through epitope mapping

    • Design of chimeric antigens combining fumarate reductase epitopes with known immunogenic proteins

  • Delivery systems:

    • Subunit vaccines using purified recombinant proteins with appropriate adjuvants

    • Live attenuated vaccines using strains with regulated expression of fumarate reductase

    • DNA vaccines encoding selected epitopes or domains

  • Evaluation framework:

    • In vitro assessment of immune responses using porcine immune cells

    • Challenge studies in appropriate animal models

    • Measurement of cross-protection against different serotypes

  • Combination approaches:

    • Inclusion of fumarate reductase components in multi-antigen vaccines

    • Targeting multiple metabolic enzymes simultaneously to prevent adaptive escape

The high conservation of metabolic proteins like fumarate reductase across different serotypes of A. pleuropneumoniae suggests that vaccines targeting this enzyme might provide broader protection than current serotype-specific vaccines .

What animal models best represent the anaerobic conditions required to study A. pleuropneumoniae fumarate reductase in vivo?

The selection of appropriate animal models for studying A. pleuropneumoniae fumarate reductase function must consider the enzyme's anaerobic mode of action. Based on the search results and established methodologies:

  • Pig aerosol infection model:

    • This model has been successfully used to evaluate the attenuation of fumarate reductase deletion mutants

    • It reproduces the natural infection route and creates the oxygen-limited conditions where fumarate reductase is most important

    • Parameters measured include clinical scores, reisolation scores, and lung lesion scores

  • Methodological considerations:

    • Standardized aerosol delivery systems to ensure consistent infections

    • Monitoring of oxygen levels in affected tissues to correlate with fumarate reductase expression

    • Histopathological examination to differentiate between infection patterns (e.g., fibrinous pleuropneumonia versus mild interstitial pneumonia)

  • Alternative models:

    • Ex vivo porcine lung tissue models maintaining physiological oxygen gradients

    • Respiratory epithelial cell cultures grown at air-liquid interface with controlled oxygen tension

    • Implanted tissue chambers that develop anaerobic conditions

The comparison of infection outcomes between wild-type A. pleuropneumoniae and fumarate reductase mutants in these models provides valuable insights into the enzyme's role in pathogenesis under relevant physiological conditions .

What emerging technologies show promise for studying the real-time activity of fumarate reductase during A. pleuropneumoniae infection?

Several cutting-edge technologies hold promise for monitoring fumarate reductase activity during actual infection processes:

  • In vivo imaging approaches:

    • Development of fluorescent or bioluminescent reporters linked to fumarate reductase expression

    • Construction of FRET-based sensors that change signal upon fumarate reduction

    • Adaptation of redox-sensitive probes to detect fumarate reductase activity

  • Metabolomic technologies:

    • In situ NMR spectroscopy to track fumarate/succinate ratios in infected tissues

    • Mass spectrometry imaging to map metabolite distributions in lung tissue sections

    • Stable isotope tracing to monitor carbon flux through the fumarate reductase pathway

  • Single-cell approaches:

    • RNA-seq of bacteria isolated from different microenvironments within infected lungs

    • Protein-level sensors that can be detected by flow cytometry

    • Cryo-electron tomography to visualize fumarate reductase complexes in bacteria from infected tissues

  • Host-pathogen interface analysis:

    • Dual RNA-seq to simultaneously monitor bacterial and host responses

    • Spatial transcriptomics to correlate fumarate reductase expression with local tissue conditions

    • Proteomics approaches to detect post-translational modifications affecting enzyme activity

These technologies would provide unprecedented insights into how A. pleuropneumoniae modulates fumarate reductase activity in response to the dynamic conditions encountered during infection, potentially revealing new targets for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.