Recombinant Actinobacillus pleuropneumoniae serotype 3 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Actinobacillus pleuropneumoniae Serotype 3 Glycerol-3-Phosphate Acyltransferase (plsY)

Recombinant Actinobacillus pleuropneumoniae serotype 3 Glycerol-3-phosphate acyltransferase (plsY) is a bacterially expressed protein critical for phospholipid biosynthesis in this porcine respiratory pathogen. This enzyme catalyzes the acylation of glycerol-3-phosphate, a key step in forming phosphatidic acid, a precursor for membrane lipids . The recombinant version, fused to an N-terminal His tag, enables purification and functional studies of this essential metabolic enzyme .

Applications in Research

The recombinant plsY protein has been utilized in:

  1. Antigenicity Studies: Screened as part of lipoprotein panels to identify vaccine candidates, though it was not among the top protective antigens .

  2. Enzyme Kinetics: Characterization of substrate specificity and inhibitor sensitivity .

  3. Structural Biology: Crystallization trials to resolve its mechanism of acyl transfer .

Comparative Analysis Across Serotypes

plsY is conserved across A. pleuropneumoniae serotypes, but recombinant variants (e.g., serotype 7 plsY, B3GYC1) show <5% amino acid divergence from the serotype 3 version . This conservation suggests plsY is a stable target for broad-spectrum interventions despite serotypic diversity .

Challenges and Future Directions

Current limitations include:

  • Lack of direct linkage between plsY activity and virulence in animal models

  • Limited data on immunogenicity compared to outer membrane lipoproteins like APJL_0922
    Future research should explore plsY’s interaction with host cells and its potential as a metabolic inhibitor target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development for your order.
Synonyms
plsY; APJL_1359; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Target Names
plsY
Target Protein Sequence
MSITVYLLIVFAYLLGSVSSAIIFCRLAGLPDPRENGSHNPGATNVLRIGGKFSALGVLL FDILKGGLPVLLAFNFKLEPSEIGLIALAACLGHIFPLFFRFRGGKGVATAFGALLSISF AASAAGLCTWLIVFLLFGYSSLSAVITALIMPFYIWWFLPEFTFPVALVCCLLVYRHHDN IQRLWRGQEQPMWARK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Actinobacillus pleuropneumoniae and why is it significant in research?

Actinobacillus pleuropneumoniae is a Gram-negative bacterium that colonizes the upper respiratory tract of pigs and causes porcine pleuropneumonia, a common respiratory infection characterized by acute hemorrhagic to chronic necrotic-fibrinous pleuropneumonia. This pathogen is of significant importance in veterinary research and the pig industry due to the substantial economic losses it causes worldwide . The disease is highly contagious and often fatal, with symptoms including severe cough, dyspnea, fever, and high mortality rates during acute outbreaks . The pathogen is transmitted through aerosol or direct contact with infected pigs, and the course of disease can range from peracute to chronic . Asymptomatic carrier pigs represent a major source for introducing the bacterium into previously uninfected herds, making control particularly challenging .

Research on A. pleuropneumoniae is significant because current vaccination strategies often lack reliable cross-serotype protection, whereas pigs surviving natural infection develop at least partial protection against clinical symptoms upon reinfection with any serotype . This suggests that identifying conserved protective antigens could lead to more effective vaccine development.

What is the molecular function of glycerol-3-phosphate acyltransferase (plsY) in Actinobacillus pleuropneumoniae?

Glycerol-3-phosphate acyltransferase (plsY) in A. pleuropneumoniae functions as a critical enzyme in phospholipid biosynthesis. Also known as acyl-phosphate--glycerol-3-phosphate acyltransferase, this enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) . This reaction represents the first committed step in the biosynthesis of membrane phospholipids, which are essential components of bacterial cell membranes.

The plsY protein in A. pleuropneumoniae serotype 7 consists of 196 amino acids with a sequence that includes several transmembrane domains, reflecting its function as a membrane-associated enzyme . The protein's importance stems from its essential role in bacterial membrane biogenesis, making it a potential target for antibacterial agents. Additionally, as a conserved protein across bacterial species, plsY may serve as an antigenic target for developing cross-protective vaccines.

How does recombinant plsY differ from native plsY in structure and function?

Recombinant plsY proteins are typically produced with affinity tags (such as the His-tag mentioned in source material for serotype 7) to facilitate purification and detection . These modifications can potentially influence protein folding, stability, and enzymatic activity compared to the native form. The recombinant version is often expressed in heterologous systems like E. coli, which may result in differences in post-translational modifications compared to the protein produced in A. pleuropneumoniae.

When analyzing functional differences, recombinant plsY may require different conditions for optimal activity than the native membrane-embedded protein. Native plsY functions within the membrane environment where substrate availability and local pH conditions are regulated, whereas recombinant versions often lack this natural context. Additionally, depending on the expression system used, the recombinant protein may form inclusion bodies requiring refolding procedures that can impact the final structural conformation.

For structural studies, researchers should consider validating that the recombinant protein maintains its native structure through circular dichroism, limited proteolysis, or other structural analysis techniques. Enzymatic assays comparing the activity of purified recombinant plsY with membrane preparations containing native plsY can help assess functional equivalence.

What expression systems are optimal for producing functional recombinant A. pleuropneumoniae plsY?

The optimal expression system for recombinant A. pleuropneumoniae plsY should be selected based on the experimental objectives and downstream applications. E. coli remains the most commonly used system due to its rapid growth, high protein yields, and well-established genetic manipulation tools. Based on the literature, E. coli has been successfully used to express recombinant plsY from serotype 7 of A. pleuropneumoniae .

For membrane proteins like plsY, E. coli strains designed to handle membrane proteins (such as C41/C43(DE3) or Lemo21(DE3)) often yield better results than standard BL21(DE3) strains. Expression conditions should be optimized to prevent aggregation and inclusion body formation, typically through reduced temperature (16-25°C), lower inducer concentrations, and the addition of membrane-stabilizing agents.

Alternatively, for studies requiring post-translational modifications or when E. coli expression yields non-functional protein, yeast systems (Pichia pastoris or Saccharomyces cerevisiae) might be considered. These eukaryotic systems can sometimes better accommodate membrane proteins, though expression levels may be lower.

The following table summarizes key expression systems and their considerations for recombinant plsY production:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, simple, economicalInclusion body formation, limited membrane protein foldingLow temperature (16-25°C), reduced inducer, co-expression with chaperones
E. coli C41/C43(DE3)Specialized for membrane proteinsLower yield than standard strainsAuto-induction media, extended expression time
Yeast (P. pastoris)Better protein folding, glycosylation capabilityLonger expression time, complex mediaMethanol induction optimization, multi-copy integrants
Cell-free systemsRapid, direct access to reaction conditionsExpensive, limited scaleSupplement with lipid vesicles or detergents

What purification strategies yield the highest purity and activity of recombinant plsY?

Purification of membrane proteins like plsY requires specialized approaches to maintain structure and function. Based on available literature, a successful strategy for purifying His-tagged recombinant plsY from A. pleuropneumoniae serotype 7 has been documented , which can serve as a starting point for serotype 3 plsY purification.

The purification protocol should begin with optimized cell lysis conditions, typically using a combination of enzymatic treatment (lysozyme) and mechanical disruption (sonication or homogenization) in the presence of protease inhibitors. Membrane fraction isolation through differential centrifugation is often necessary before solubilization.

For membrane proteins like plsY, the critical step is solubilization using appropriate detergents. A screen of different detergents (n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin) at various concentrations should be performed to identify conditions that effectively solubilize plsY while maintaining its activity.

Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the method of choice for His-tagged plsY, with careful optimization of imidazole concentrations in wash and elution buffers to minimize non-specific binding while maximizing recovery. For highest purity, size exclusion chromatography (SEC) can be used as a polishing step.

The purified protein should be stored in a stabilizing buffer containing appropriate detergent at concentrations above its critical micelle concentration, often with glycerol (10-20%) and reducing agents to prevent oxidation. Activity assays should be performed immediately after purification to establish baseline enzymatic function.

How can the structural integrity and enzymatic activity of purified recombinant plsY be validated?

Validating the structural integrity and enzymatic activity of purified recombinant plsY is essential to ensure that the protein resembles its native form. Multiple complementary techniques should be employed for comprehensive characterization.

Enzymatic activity validation is crucial and should be performed using assays that monitor the transfer of acyl groups to glycerol-3-phosphate. Activity can be measured by:

  • Radiometric assays using 14C-labeled acyl-ACP or acyl-phosphate substrates

  • Coupled enzyme assays that monitor reaction products through colorimetric or fluorometric detection

  • HPLC-based methods to separate and quantify reaction products

A comprehensive validation approach might include the following parameters:

Validation ParameterMethodExpected Outcome for Functional plsY
PuritySDS-PAGE, SEC-MALS>95% purity, monodisperse population
Secondary structureCircular dichroismAlpha-helical content consistent with membrane proteins
Thermal stabilityDifferential scanning fluorimetryDefined melting temperature that shifts with substrate binding
Substrate bindingIsothermal titration calorimetryMeasurable binding affinity for acyl-phosphate and G3P
Enzymatic activityAcyltransferase activity assayMichaelis-Menten kinetics with defined Km and Vmax
Inhibitor sensitivityActivity assays with known inhibitorsDose-dependent inhibition with expected IC50 values

How can recombinant plsY be utilized to study A. pleuropneumoniae pathogenesis?

Recombinant plsY can serve as a valuable tool for investigating A. pleuropneumoniae pathogenesis through multiple research approaches. As a membrane-associated enzyme involved in phospholipid biosynthesis, plsY plays a crucial role in maintaining membrane integrity, which is essential for bacterial survival and virulence.

Researchers can use recombinant plsY to develop inhibition assays for screening potential antimicrobial compounds that target phospholipid biosynthesis. By establishing high-throughput screening platforms with purified recombinant plsY, compounds that specifically inhibit this enzyme can be identified as potential therapeutic agents against A. pleuropneumoniae infections.

Another important application involves generating antibodies against recombinant plsY for immunolocalization studies. These antibodies can be used to track the expression and distribution of plsY during different stages of infection, providing insights into its potential role in pathogenesis. Additionally, these antibodies can be used to detect A. pleuropneumoniae in clinical samples, potentially differentiating between serotypes if specific epitopes are targeted.

Recombinant plsY can also facilitate structure-function studies through site-directed mutagenesis. By creating specific mutations in the recombinant protein and assessing their effects on enzymatic activity, researchers can identify critical residues involved in catalysis or substrate binding. This information can guide the design of inhibitors that specifically target these regions.

For studying host-pathogen interactions, recombinant plsY can be used in binding assays with host cell components to investigate potential moonlighting functions beyond its enzymatic role. Some bacterial enzymes have been shown to have secondary functions in adhesion or immune evasion, and similar investigations with plsY could reveal unexpected roles in virulence.

What is the potential of plsY as a vaccine candidate against A. pleuropneumoniae infections?

The potential of plsY as a vaccine candidate against A. pleuropneumoniae warrants investigation based on several factors that make it a promising target. While not specifically mentioned in the search results for plsY, the literature on A. pleuropneumoniae vaccine development provides relevant insights that can be applied to evaluating plsY's potential.

Several characteristics favor plsY as a vaccine candidate:

  • Conservation across serotypes: If plsY shows high sequence conservation across the 18 known serotypes of A. pleuropneumoniae, it could potentially elicit cross-protective immunity, addressing a major limitation of current vaccines that lack reliable cross-serotype protection .

  • Essentiality: As an enzyme involved in membrane phospholipid biosynthesis, plsY is likely essential for bacterial survival, making it difficult for the pathogen to evade immunity through deletion or major modifications of this protein.

  • Surface accessibility: If portions of the plsY protein are exposed on the bacterial surface, these regions could be targets for antibody binding, potentially neutralizing bacterial activity or marking bacteria for immune clearance.

To evaluate plsY as a vaccine candidate, researchers should follow a systematic approach:

  • Immunogenicity assessment: Similar to the approach used for other A. pleuropneumoniae lipoproteins, recombinant plsY should be tested for its ability to elicit strong antibody responses in mice and pigs .

  • Protection studies: Immunized animals should be challenged with virulent A. pleuropneumoniae strains of both homologous and heterologous serotypes to assess protective efficacy .

  • Epitope mapping: Identifying the specific epitopes that elicit protective immunity can guide the design of more focused subunit vaccines that include only the immunoprotective regions of plsY.

The search results indicate that researchers have successfully identified protective lipoproteins in A. pleuropneumoniae through systematic screening approaches . Three lipoproteins (APJL_0922, APJL_1380, and APJL_1976) generated efficient immunoprotection in mice against lethal heterologous challenge and elicited effective protective immunity in pigs . While plsY was not specifically mentioned among these candidates, a similar approach could be applied to evaluate its vaccine potential.

How does serotype variation impact the structure and function of plsY across different A. pleuropneumoniae isolates?

Serotype variation in A. pleuropneumoniae can potentially impact the structure and function of plsY, though the extent of this impact likely depends on evolutionary conservation pressures on this essential enzyme. With 18 recognized serotypes of A. pleuropneumoniae , understanding the variations in plsY across these serotypes is crucial for both basic research and applied vaccine development.

Based on general principles of bacterial evolution and the nature of essential metabolic enzymes, we can make several informed inferences about potential serotype-related variations in plsY:

  • Core functional domains of plsY likely show high sequence conservation across serotypes due to selective pressure to maintain enzymatic function. The catalytic site and substrate-binding regions would be expected to show minimal variation to preserve the essential acyltransferase activity.

  • Surface-exposed regions of plsY might exhibit greater sequence variability between serotypes, potentially as a mechanism to evade host immune recognition. These variable regions could impact antibody recognition and cross-reactivity between serotypes.

  • Post-translational modifications or regulatory mechanisms affecting plsY activity could vary between serotypes, potentially contributing to differences in membrane composition, stress resistance, or virulence.

To systematically analyze serotype variation in plsY, researchers should:

  • Perform comparative sequence analysis of plsY genes from multiple strains representing all 18 serotypes to identify conserved and variable regions. This should include both nucleotide and amino acid sequence comparisons, with particular attention to non-synonymous substitutions that might affect protein function.

  • Conduct structural modeling to predict how identified sequence variations might impact protein folding, substrate binding, or catalytic activity. Homology modeling based on crystal structures of related acyltransferases can provide insights into the functional significance of observed variations.

  • Express and purify recombinant plsY from multiple serotypes to compare biochemical properties, including substrate specificity, kinetic parameters, and stability under different conditions. Differences in these properties could reflect adaptations to specific host environments or growth conditions.

  • Assess antigenic cross-reactivity using antibodies raised against plsY from one serotype to recognize plsY from other serotypes. This would help determine whether serotype variations affect potential immune recognition, which is crucial for vaccine applications.

What are the common challenges in expressing membrane-associated proteins like plsY and how can they be overcome?

Expressing membrane-associated proteins like plsY presents several distinct challenges compared to soluble proteins. Based on general principles of membrane protein expression and the specific information about plsY from A. pleuropneumoniae serotype 7 , researchers can anticipate and address the following challenges:

  • Protein toxicity to the expression host: Overexpression of membrane proteins often disrupts host cell membrane integrity, leading to growth inhibition or cell death. To overcome this:

    • Use tightly regulated expression systems with minimal basal expression

    • Employ specialized E. coli strains like C41/C43(DE3) designed to tolerate toxic membrane proteins

    • Reduce expression temperature to 16-20°C and inducer concentration to minimize toxicity while maintaining adequate expression levels

  • Protein misfolding and aggregation: Membrane proteins require specific lipid environments for proper folding. To address this:

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist in proper folding

    • Include mild detergents or lipids in the culture medium to provide a suitable hydrophobic environment

    • Consider fusion tags that enhance solubility (SUMO, thioredoxin) while maintaining the option to remove them post-purification

  • Low expression yields: Membrane proteins typically express at lower levels than soluble proteins. To improve yields:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider using specialized media formulations like Terrific Broth with added glycerol

    • Extend expression time at lower temperatures (48-72 hours at 16°C)

  • Inefficient extraction and purification: Membrane proteins require detergents for extraction from membranes. To optimize this process:

    • Screen multiple detergents (DDM, LMNG, digitonin) for optimal solubilization without denaturing the protein

    • Use a two-step solubilization approach: initial mild solubilization followed by more stringent conditions

    • Add stabilizing agents like cholesterol hemisuccinate or specific lipids during purification

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for extraction in a more native-like environment

The following table summarizes detergent screening approaches for membrane protein purification:

Detergent ClassExamplesPropertiesBest For
MaltosidesDDM, UDMMild, good for preserving activityInitial screening, functional studies
GlucosidesOG, NGMedium harshness, smaller micellesCrystallography studies
Neopentyl glycolsLMNG, MNG-3High stability, low CMCLong-term stability, cryo-EM
ZwitterionicFC-12, LDAOHarsher, good solubilizationHighly hydrophobic proteins
AmphipolsA8-35, PMALPolymer-based, stabilizingDetergent-free maintenance

How can enzymatic activity of recombinant plsY be accurately measured and standardized?

Accurately measuring and standardizing the enzymatic activity of recombinant plsY requires carefully designed assays that account for its membrane-associated nature and specific substrate requirements. The following methodological approaches can be implemented:

  • Direct acyltransferase activity assay: This measures the primary function of plsY, which is the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate to form lysophosphatidic acid (LPA).

    • Substrate preparation: Synthesize or obtain purified acyl-phosphate donors and glycerol-3-phosphate

    • Detection methods:
      a) Radiometric: Using 14C-labeled substrates with thin-layer chromatography separation and scintillation counting
      b) HPLC-MS: Separate and quantify reaction products using liquid chromatography coupled with mass spectrometry
      c) Colorimetric: Couple the reaction to the release of inorganic phosphate, which can be detected using malachite green or other phosphate detection reagents

  • Coupled enzyme assays: These indirect methods couple plsY activity to other enzymatic reactions that produce measurable signals.

    • For example, couple the production of LPA to a phosphatase that releases inorganic phosphate, which can then be detected colorimetrically

    • Alternatively, use downstream enzymes in the phospholipid biosynthesis pathway to convert LPA to detectable products

  • Biophysical binding assays: These measure substrate binding rather than catalytic activity but can provide valuable information about enzyme-substrate interactions.

    • Isothermal titration calorimetry (ITC) to measure binding affinities and thermodynamic parameters

    • Surface plasmon resonance (SPR) to measure real-time binding kinetics

    • Microscale thermophoresis (MST) for binding studies with minimal protein consumption

For standardization and quality control, the following parameters should be established:

ParameterMethodPurpose
Specific activityUnits of product formed per mg protein per minuteAllows comparison between different preparations
Substrate affinity (Km)Kinetic analysis at varying substrate concentrationsConfirms proper substrate binding properties
Turnover number (kcat)Calculate from Vmax and enzyme concentrationMeasures catalytic efficiency
pH and temperature optimaActivity assays under varying conditionsEstablishes optimal reaction conditions
Inhibition profileActivity in presence of known inhibitorsConfirms expected pharmacological properties
Detergent compatibilityActivity in different detergent systemsIdentifies optimal conditions for in vitro studies

What controls should be included in immunogenicity studies involving recombinant plsY?

Immunogenicity studies involving recombinant plsY require rigorous controls to ensure valid and reproducible results. Based on practices described in the literature for A. pleuropneumoniae vaccine studies , the following controls should be included:

  • Antigen quality controls:

    • Purity assessment: SDS-PAGE and western blotting to confirm the absence of contaminating proteins that might contribute to immune responses

    • Endotoxin testing: Limulus amebocyte lysate (LAL) assay to ensure endotoxin levels are below acceptable limits for immunization

    • Stability analysis: Size-exclusion chromatography or dynamic light scattering to confirm the absence of protein aggregation prior to immunization

    • Activity testing: Enzymatic assays to confirm that the recombinant plsY maintains native-like functional properties

  • Immunization controls:

    • Adjuvant-only group: Animals receiving only the adjuvant formulation without plsY to differentiate adjuvant-induced effects from antigen-specific responses

    • Irrelevant protein control: Animals immunized with an unrelated protein (e.g., bovine serum albumin) prepared under identical conditions to control for general protein immunization effects

    • Positive control: Animals immunized with a known protective antigen from A. pleuropneumoniae to benchmark immune responses

    • Unimmunized control: Naïve animals to establish baseline immunological parameters

  • Serological analysis controls:

    • Pre-immune sera: Samples collected before immunization to establish baseline antibody levels

    • Isotype controls: Analysis of different antibody isotypes (IgG, IgA, IgM) to characterize the quality of immune responses

    • Cross-reactivity controls: Testing sera against other A. pleuropneumoniae proteins to assess specificity

    • Epitope mapping controls: Including peptides representing different regions of plsY to identify immunodominant epitopes

  • Challenge study controls:

    • Heterologous challenge: Using A. pleuropneumoniae strains of different serotypes to assess cross-protection

    • Dose-response controls: Multiple challenge doses to determine the level of protection

    • Carrier state assessment: Monitoring bacterial shedding and colonization in addition to clinical protection

    • Clinical parameter controls: Standardized scoring systems for clinical signs, pathological lesions, and bacterial recovery

  • Technical and analytical controls:

    • Randomization and blinding procedures to minimize bias

    • Power analysis to ensure adequate sample sizes for statistical significance

    • Appropriate statistical tests with multiple comparison corrections

    • Reproducibility controls through independent replication of key experiments

What emerging technologies could enhance our understanding of plsY function in A. pleuropneumoniae?

Several cutting-edge technologies could significantly advance our understanding of plsY function in A. pleuropneumoniae, opening new avenues for both basic research and applied therapeutics. These approaches extend beyond traditional biochemical and microbiological methods to provide deeper insights into protein function in more native-like contexts.

CRISPR-Cas9 genome editing offers powerful opportunities to study plsY in its native context. While complete knockout may not be feasible if plsY is essential, conditional expression systems or targeted mutations can help determine how specific residues or domains contribute to function in vivo. CRISPRi (CRISPR interference) approaches could allow titratable repression of plsY expression to examine the consequences of reduced plsY activity on bacterial growth, membrane composition, and virulence.

Cryo-electron microscopy (cryo-EM) represents a transformative approach for determining the structure of membrane proteins like plsY without the need for crystallization. Single-particle cryo-EM could reveal the precise structural arrangement of plsY within the membrane, including potential oligomerization states and conformational changes during catalysis. This structural information would significantly enhance our understanding of plsY function and guide rational drug design efforts.

Advanced lipidomics using high-resolution mass spectrometry can provide comprehensive profiles of membrane lipid composition in wild-type versus plsY-modified A. pleuropneumoniae strains. This approach would reveal how alterations in plsY activity affect the bacterium's membrane composition, potentially identifying novel lipid species or altered lipid ratios that could influence membrane properties, antibiotic resistance, and host-pathogen interactions.

Protein-protein interaction networks involving plsY could be mapped using proximity labeling techniques like BioID or APEX, which work by tagging proteins that come into close contact with plsY in living cells. This would help identify potential regulatory partners, multienzyme complexes, or unexpected interactions with host factors during infection.

For in vivo tracking and functional studies, fluorescent protein fusions or self-labeling enzyme tags (SNAP, CLIP, or Halo tags) attached to plsY could allow real-time visualization of protein localization and dynamics during bacterial growth and infection. This approach could reveal whether plsY relocates within the cell under different conditions or during specific stages of infection.

How might structural biology approaches advance plsY-targeted therapeutic development?

Structural biology approaches offer tremendous potential for advancing plsY-targeted therapeutic development against A. pleuropneumoniae infections. Understanding the three-dimensional structure of plsY at atomic resolution would provide the foundation for rational drug design efforts targeting this essential enzyme.

X-ray crystallography remains a gold standard for high-resolution protein structure determination. While membrane proteins like plsY are challenging to crystallize, specialized approaches using lipidic cubic phase (LCP) crystallization have proven successful for many membrane proteins. The resulting structures could reveal the precise arrangement of the active site, substrate binding pockets, and potential allosteric sites that could be targeted by inhibitors.

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins by eliminating the need for crystallization. For plsY, single-particle cryo-EM could provide high-resolution structures of the protein in different functional states, potentially capturing conformational changes during the catalytic cycle. This dynamic information is particularly valuable for drug design, as it can reveal transient binding pockets not visible in static structures.

Nuclear magnetic resonance (NMR) spectroscopy complements other structural methods by providing information about protein dynamics in solution. While determining the complete structure of plsY by NMR would be challenging due to its size and membrane association, targeted NMR studies of specific domains or in the presence of ligands could provide valuable insights into flexibility, ligand binding, and allosteric effects.

Molecular dynamics (MD) simulations can extend experimental structural data by modeling how plsY behaves within a lipid bilayer environment over time. These computational approaches can predict how potential inhibitors might interact with plsY, accounting for membrane effects that are difficult to capture experimentally. MD simulations can also identify cryptic binding sites that only become accessible during certain conformational states.

Structure-based drug design workflows that could be applied once plsY structural data is available include:

  • Virtual screening of compound libraries against identified binding sites

  • Fragment-based drug design starting with small molecular scaffolds that can be optimized

  • Peptidomimetic approaches targeting protein-protein interaction surfaces

  • Structure-guided design of transition state analogs that inhibit catalytic activity

The following table outlines the complementary structural biology approaches and their specific applications to plsY-targeted therapeutics:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.