Recombinant Actinobacillus pleuropneumoniae serotype 3 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

General Information

Actinobacillus pleuropneumoniae is a Gram-negative bacterium that causes porcine contagious pleuropneumonia (PCP), a severe respiratory disease in pigs, leading to significant economic losses in the swine industry . A. pleuropneumoniae has various serotypes, with serotype 3 being a low-virulence serotype, although it can still cause disease .

Mechanosensitive channels (MSCs) are membrane proteins that respond to mechanical stimuli, such as changes in osmotic pressure, by opening a channel that allows ions and other small molecules to pass through the cell membrane . Large-conductance mechanosensitive channels (MscL) are a specific type of MSC that allows for the rapid efflux of solutes to alleviate osmotic stress . MscL plays a vital role in bacterial resistance to external environmental changes, ensuring normal bacterial growth .

Function and Significance of MscL in A. pleuropneumoniae

MscL in A. pleuropneumoniae is crucial for several functions :

  • Osmotic Adaptation: MscL helps the bacterium adapt to changes in environmental osmolarity by regulating cell length, thus preventing drastic rises or falls in osmotic pressure .

  • Antibiotic Resistance: MscL influences the bacterium's sensitivity to multiple antibiotics. Deletion of the mscL gene can decrease the sensitivity of A. pleuropneumoniae to antibiotics such as chloramphenicol, erythromycin, and penicillin .

  • Biofilm Formation: MscL plays a role in biofilm formation, which is a critical factor in bacterial survival and virulence .

  • Virulence: MscL and MscS do not affect the virulence of A. pleuropneumoniae .

MscL Structure and Homology

The MscL sequence of A. pleuropneumoniae shares significant homology with MscL from other bacterial species, such as E. coli . Amino acid sequence identity between A. pleuropneumoniae and E. coli MscL is approximately 76% . Conserved motifs, such as transmembrane domains (TM1 and TM2), are present in the MscL sequence of A. pleuropneumoniae, with high homology to E. coli .

Impact of MscL Deletion on Antibiotic Sensitivity

Deletion of the mscL gene affects the sensitivity of A. pleuropneumoniae to various antibiotics :

AntibioticEffect of mscL Deletion
ChloramphenicolDecreased sensitivity
ErythromycinDecreased sensitivity
PenicillinDecreased sensitivity
OxacillinDecreased sensitivity
Other antibioticsSensitivity of the ∆mscS to penicillin increased, but the sensitivity of ∆ mscL and ∆ mscL-∆ mscS decreased

Recombinant Production and Applications

Recombinant MscL protein can be produced using various expression systems. It is used in research for studying the function and characteristics of the channel . Recombinant MscL is available for purchase for research purposes .

Table of Internalization Percentage of A. pleuropneumoniae Strains

The internalization capacity of different A. pleuropneumoniae strains in swine aortic endothelial cells is shown in the table below :

StrainInternalization Percentage
S40741.3%
JL034.6%
L201.75%
AP761.6%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; APJL_1625; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Target Names
mscL
Target Protein Sequence
MSILKEFREFAVKGNVVDMAVGVIIGGAFGKIVSSLVSDVVMPPIGWLIGGVDFKDLAIE IAPAKEGAEAVMLKYGAFIQNVFLLGVIAIAADGMGTLINKIKKPAEAAPAEPTAEEKLL TEIRDLLKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces within the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.